PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1864
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 363aa    MW: 41004.6 Da    PI: 9.5267
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1864genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3380.72.2e-116383291293
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmwkd ++l+r+ker++     +    +a++ n+++e arrkk+sr QDgiLk Ml  mev+na+GfvYgi+pe+gk v+gasd+LraWWkek
  Gh_A13G1864  38 DELERRMWKDSVRLRRIKERERVAA--Q----QAAELNQTSELARRKKISRVQDGILKNMLMLMEVYNARGFVYGIVPENGKAVSGASDNLRAWWKEK 129
                  79******************99743..3....3456789*********************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+ky+a++l+++ ++++  ++ +  +sl++lqD+t+gSLLs+lmqhcdppqr++plek ++pPWWPtG+e+ww +lgl++  + ppyk
  Gh_A13G1864 130 VNFDKNGPAAIVKYEAECLAMNVSDRN--RNGNPCSSLQDLQDATIGSLLSTLMQHCDPPQRKYPLEKRIPPPWWPTGNEDWWVKLGLQRGDS-PPYK 224
                  ********************9977777..6789999*****************************************************9998.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.......XXXX.XXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.......slrk.qspkvtlsceqkedv 284
                  kphdlkk+wkv+vLtavikhmsp+i++i+++++qsk+lq k +akes+++l vl++ee++++t s    s+       +    +++   +s++++ ++
  Gh_A13G1864 225 KPHDLKKMWKVGVLTAVIKHMSPDIAKIQRHVLQSKCLQGKLTAKESAIWLGVLGREEALIRTSSITeiSRgghadsnN--VvGNQIRSVSSKNNGRN 320
                  **************************************************************99988654444443221..12222222333333344 PP

                  XXXXXXX.X CS
         EIN3 285 egkkeskik 293
                  + ++++ ++
  Gh_A13G1864 321 QLTDAEPVA 329
                  433333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.1E-11338282No hitNo description
Gene3DG3DSA:1.10.3180.108.0E-67161288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.67E-59164285IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MAELDDTGGD ISWDIEVSEL KRDNMGEEDV SDEEIRADEL ERRMWKDSVR LRRIKERERV  60
AAQQAAELNQ TSELARRKKI SRVQDGILKN MLMLMEVYNA RGFVYGIVPE NGKAVSGASD  120
NLRAWWKEKV NFDKNGPAAI VKYEAECLAM NVSDRNRNGN PCSSLQDLQD ATIGSLLSTL  180
MQHCDPPQRK YPLEKRIPPP WWPTGNEDWW VKLGLQRGDS PPYKKPHDLK KMWKVGVLTA  240
VIKHMSPDIA KIQRHVLQSK CLQGKLTAKE SAIWLGVLGR EEALIRTSSI TEISRGGHAD  300
SNNVVGNQIR SVSSKNNGRN QLTDAEPVAL IGNDDAPLVQ EDVPVEKQSR RKRPRLRSSR  360
GGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-7116528812135ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1350356RKRPRLR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.234730.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012464525.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
SwissprotO231161e-145EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0D2VK290.0A0A0D2VK29_G
STRINGPOPTR_0001s05360.11e-170(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-144ETHYLENE-INSENSITIVE3-like 3