PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 323aa    MW: 36152.4 Da    PI: 8.2904
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1701genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1032.8e-32186242158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  dep+YVN+KQy++Il+RRq Rakle+++kl  ksrkpylheSRh+hAl+R RgsgGrF
  Gh_A13G1701 186 DEPIYVNPKQYHGILRRRQYRAKLEAQNKL-VKSRKPYLHESRHRHALNRVRGSGGRF 242
                  79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.7E-36184245IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.017185245IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.0E-27187242IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-23188210IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.4E-23219242IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAVRVQNFPK KTFDESSVRS LSHLSVSCTP WWSLNEQQIE EPLPHNISLK VETPSQLYHQ  60
AKHLDLQLPD QELTTVQAID RTHCEVGAIG VTSSQRDPSE SAGPFESCEK DTEGQVKPVF  120
LVNNPNTLFS PSHQNYNHSM ACTQYPYANA YFNGLFTPYG PQAIIQAQLG GNAPTRIPLP  180
LDLAEDEPIY VNPKQYHGIL RRRQYRAKLE AQNKLVKSRK PYLHESRHRH ALNRVRGSGG  240
RFLSKKTLQQ PNVICNNQTN SISELESHYS RMAGYDGPNT SCMNISSVSN NDCNFQRLEH  300
GFANISRAGG TGDGIRHGAS VVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-21186253269NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.71221e-92boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465160.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_012465161.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLA0A0B0MUX50.0A0A0B0MUX5_G
STRINGPOPTR_0006s14740.15e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1809668
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-41nuclear factor Y, subunit A3