PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1251
Common NameSPL5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 182aa    MW: 20417.8 Da    PI: 9.0818
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1251genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP139.11.3e-4354131178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C  dls+ak+yhrrhkvCe+h+kap v+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a
  Gh_A13G1251  54 ACQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKSSA 131
                  5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-3647116IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.09452129IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.59E-4153132IPR004333Transcription factor, SBP-box
PfamPF031102.5E-3355128IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MNKDFIAEEL DNDMQEEEEE GVGGDHGFPD DEKKKKGYGR RGAAGGGGGV SPPACQVEKC  60
GLDLSDAKRY HRRHKVCEIH AKAPFVVVAG LRQRFCQQCS RFHELPEFDE AKRSCRRRLA  120
GHNERRRKSS AESSSAAESS NRRGMMISAQ LKESHYLADD QRARVNPMAI HGSSSFKRSQ  180
IR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3745128184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.165370.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7793400.0AY779340.1 Gossypium hirsutum SBP transcription factor mRNA, complete cds.
GenBankKJ6223130.0KJ622313.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463358.11e-130PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ9S7A94e-47SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A088DLF61e-132A0A088DLF6_G
TrEMBLA0A0B0MZF71e-132A0A0B0MZF7_G
STRINGPOPTR_0001s40870.15e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-38squamosa promoter binding protein-like 5
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]