PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 367aa    MW: 40070 Da    PI: 5.3487
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0177genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573132.41.7e-41149245298
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  lfqrl+se+Dei+lL+G++d+ ak+g +p +d+++fyefvkksi+ +vsk ql++KirrLKkKfk++  k ++g++p+fsk+h+q++felsk+iWg+
  Gh_A13G0177 149 LFQRLFSEDDEIALLKGMLDYSAKKGDDPCADMNEFYEFVKKSIHTDVSKVQLMDKIRRLKKKFKNNAGKNNKGEDPTFSKPHEQNAFELSKQIWGK 245
                  69*********************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.8E-36150244IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAPKRSNPIE VPPAASSSEE DEEVTSSGEV DEGSSTEEED EDDPKTQSTP LSQKSPSPRK  60
LETATPAIVK EESDESGSDS ESDTAAQIAI ATKPRCNKPL ASSSKRPGES ELDAKEAKRP  120
KKKVGEEGMA TAPVVEGVKK TGEDAKKLLF QRLFSEDDEI ALLKGMLDYS AKKGDDPCAD  180
MNEFYEFVKK SIHTDVSKVQ LMDKIRRLKK KFKNNAGKNN KGEDPTFSKP HEQNAFELSK  240
QIWGKEGISG KVASSTAKSN GKAKGNNKAE IAVKADLLSS SDKKIDDAVP VVSKSSSSFL  300
DKKFSLSDLE EAVVKVGLDI VDGEKKAALE AKWMKLQVAQ LEAYARRTEF VAEQAKLLLK  360
YYKSEEK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.15820.0boll| ovule| root| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512650.0JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465288.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A0D2W2020.0A0A0D2W202_G
STRINGPOPTR_0001s30110.14e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-28DNA-binding storekeeper protein-related transcriptional regulator