PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 213aa    MW: 23676.1 Da    PI: 8.2878
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0040genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.2e-42481471100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da+sslvyeA++r+rdPvyG++g i++lqqq+++l+ae+++++
  Gh_A13G0040  48 PCAACKLLRRRCAEECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPENQRADAASSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAEINAVR 145
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_A13G0040 146 AE 147
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58647148IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4248145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MCVFRERFDE IGKKIKREAD VVSFGGHHHQ MGRRHIMGSH GTLNTITPCA ACKLLRRRCA  60
EECPFSPYFS PHEPQKFASV HKVFGASNVS KMLMEVPENQ RADAASSLVY EANVRLRDPV  120
YGCMGAISAL QQQVQSLQAE INAVRAEIMK HKCREANLIP SPSHLALLSS GAVSIAAPPP  180
MPLPQPTTAA DYNTISDENV TYTLDNKYYI DKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-474816111124LOB family transfactor Ramosa2.1
5ly0_B2e-474816111124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017618787.11e-156PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T59e-78LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2P5YHD31e-155A0A2P5YHD3_GOSBA; Uncharacterized protein
STRINGGorai.013G005900.11e-131(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-79LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]