PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G2355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 137aa    MW: 15605.8 Da    PI: 9.0104
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G2355genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.72.3e-3951041100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C++dC+++pyfp ++p++fa +h+++Gasnv kll++lp + r++a++sl+ eA+ r++dPvyG+vg+i+ lqqq++  + +la+++
  Gh_A12G2355   5 RCAACRYLRRRCPPDCIFSPYFPPNNPQRFASIHRIYGASNVAKLLQRLPSHLRTQAADSLYLEAQYRIEDPVYGCVGLISLLQQQIHDIERQLAMTQ 102
                  6**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_A12G2355 103 AE 104
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6614105IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-405102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MNPSRCAACR YLRRRCPPDC IFSPYFPPNN PQRFASIHRI YGASNVAKLL QRLPSHLRTQ  60
AADSLYLEAQ YRIEDPVYGC VGLISLLQQQ IHDIERQLAM TQAEIAFRAR HPQAVEGNLL  120
NNVGNPSFSN QASSWFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-41610512111LOB family transfactor Ramosa2.1
5ly0_B8e-41610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017636051.12e-98PREDICTED: LOB domain-containing protein 24-like
SwissprotP594687e-52LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2P5WY404e-97A0A2P5WY40_GOSBA; Uncharacterized protein
STRINGGorai.008G280400.18e-94(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-43LOB domain-containing protein 24