PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0866
Common NameSPL10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 358aa    MW: 40079.6 Da    PI: 8.4265
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0866genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.5e-41123200178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC++ l +ak+yhrrhkvCe+hskap+v+v gleqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk+++
  Gh_A12G0866 123 RCQVEGCNVTLVNAKDYHRRHKVCETHSKAPKVVVLGLEQRFCQQCSRFHLVSEFDDSKRSCRRRLAGHNERRRKTSQ 200
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-35117185IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.641121198IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.94E-39122202IPR004333Transcription factor, SBP-box
PfamPF031102.3E-32124197IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEHDDMFMGN RSQTGNKYNP NNATTNSFNF ETTLTESHAL NHPHQQQQRY SLYAGDGSSR  60
IHQSADPHLV CLKLGKRHYF EGSTDLNNNR HSAGGFSIGK KGKPYYDNLS GEGGGPSSST  120
GPRCQVEGCN VTLVNAKDYH RRHKVCETHS KAPKVVVLGL EQRFCQQCSR FHLVSEFDDS  180
KRSCRRRLAG HNERRRKTSQ DSATRNFAHV CCQTDNKPMT GSFPYVSSPT GRALSLLSSK  240
VDSWISPSNL STRSSAALRE LIVENRAAVL ARQLVLERDW HYIGEPQPAG SNPILVQHHS  300
MLDPHRWDFP FPEIGGQVTL DLMQASNTAF GMLSVRGKTK EEEEECSELW HSLQGTHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-32115197184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.26180.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223180.0KJ622318.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437523.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
TrEMBLA0A088DLF70.0A0A088DLF7_G
STRINGPOPTR_0002s14330.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15613914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-38squamosa promoter binding protein-like 10
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]