PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0519
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 275aa    MW: 31380 Da    PI: 10.449
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0519genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57374.91.4e-2359151297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  +fqr+wse Dei +Lq+l+     +  s  +d+  fy+ +++s+s  ++ksql+eK+rrL+kKf+  +++ ++g +ps  + hd+  f+lsk++W 
  Gh_A12G0519  59 KFQRIWSEPDEIRFLQALLRS---HPLSFPKDLPLFYSSFSHSMSQPYTKSQLSEKLRRLRKKFRVVSSRLARGLNPSSLSLHDRALFDLSKRLWS 151
                  79*****************87...5667788****************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.2E-2660151IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDSSQPHPSK PSASKLPIKR KAPHHPQFFT PKLEYQPIIL PPPKPKPKPK PQPQTPPFKF  60
QRIWSEPDEI RFLQALLRSH PLSFPKDLPL FYSSFSHSMS QPYTKSQLSE KLRRLRKKFR  120
VVSSRLARGL NPSSLSLHDR ALFDLSKRLW SPEFASSSPF GKNSSGFNGV AGNGFDDCDT  180
IDDDGEVKIN GVSLHYDFAA GRDEVTSRET IDGVLAKGVL NAFDECLKEV RMMFMKPGVV  240
CMDTTERKWK EQRVSEFDVL GRRLRLVIEN SLTRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30570.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5780580.0JX578058.1 Gossypium hirsutum clone NBRI_GE9999 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436763.11e-166PREDICTED: sorbin and SH3 domain-containing protein 2-like
TrEMBLA0A0D2SVN71e-166A0A0D2SVN7_G
STRINGPGSC0003DMT4000968754e-62(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1804289