PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G3014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 297aa    MW: 33567.3 Da    PI: 6.2216
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G3014genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.31.2e-3810108199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC ++C lapyfpa+q+k f+n+hklFG+sn++k+lk+l+++++ +am+s+ y+A++r + PvyG++gvi++l  q++  ++e +++ 
  Gh_A11G3014  10 ACAACKYQRRKCIPECLLAPYFPADQTKVFQNAHKLFGVSNIVKILKSLDPSQHAEAMRSIKYQANVRDKFPVYGCLGVIRQLYYQIQLREEEFHSVL 107
                  7****************************************************************************************999998775 PP

       DUF260  99 e 99 
                  +
  Gh_A11G3014 108 S 108
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9829110IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-3710105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTLKSGTTSA CAACKYQRRK CIPECLLAPY FPADQTKVFQ NAHKLFGVSN IVKILKSLDP  60
SQHAEAMRSI KYQANVRDKF PVYGCLGVIR QLYYQIQLRE EEFHSVLSQL EMYRQYHHEV  120
PSQLELGMAP PTNGLNFLTA VSDMPVSMQH SYSNSNNIGY CSSYVDSKDH NNNNNNSNSN  180
SNNNNNNNSL WIQHPFLATN NSSSSNSNEN NPLMAIQSQL LVSDMQPLVK QHEVVQDYDE  240
LHPFFDTIDD RQSFIHSKEP YDSSCEDSAK ETTQAIELVP NNELKNAAAC FSLTSVH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2961137114LOB family transfactor Ramosa2.1
5ly0_B4e-2961137114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6148990.0JX614899.1 Gossypium hirsutum clone NBRI_GE58613 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488173.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS63e-60LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A0D2S6930.0A0A0D2S693_GOSRA; Uncharacterized protein
STRINGGorai.007G034800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-55LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]