PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0943
Common NameSPL17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 985aa    MW: 109051 Da    PI: 6.2193
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0943genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.8e-41154231178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C adl++ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efD++krsCrrrLa+hn+rrrk+++
  Gh_A11G0943 154 VCQVEDCGADLTNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFHVLQEFDDGKRSCRRRLAGHNKRRRKTNP 231
                  6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-34148216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129152229IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-38153234IPR004333Transcription factor, SBP-box
PfamPF031107.3E-30155228IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.205.7E-5746873IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.58E-6756872IPR020683Ankyrin repeat-containing domain
CDDcd002041.94E-5758870No hitNo description
PROSITE profilePS502978.641810870IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 985 aa     Download sequence    Send to blast
MEARFGSEAH HFYGMSPADL RAVGKRTVEW DLNDWKWDGD LFIASSINPI SADTMGRQFF  60
PLGSGIPGNS SNSSSSCSDD LNPKAQKGKR ELEKKRRVTV VEDDSLNEET GSLTLKLGGQ  120
GDHGYPISQG EMKNWEGTSG KKTKLNGGSG NRAVCQVEDC GADLTNAKDY HRRHKVCEMH  180
SKASKALVGN VMQRFCQQCS RFHVLQEFDD GKRSCRRRLA GHNKRRRKTN PATVVNGNSL  240
NDEQTSGYLL LSLLKILSNM HSNRSDQTTD QDVLPQLLQS LANHTNEQGG RNISGLLPEP  300
KGSEAGSALF LNGEGPPRPF RQHITEAASE IPQKGVHSHD ARVTNVQGNA AGSVKMNNFD  360
LNDTYIDSDY GADDIEGFPA PVNMGTSSLD CPSWVQQDSH QSSPPQTSGN SDSVSAQSPS  420
SSSGDTQSRT DRIVFKLFGK EPNDFPLLLR AQILDWLSHS PTDIESYIRP GCVVLTIYLC  480
QSEAAWDELC CDLSFSLNRL LDCSDDTFWR TGWICTRVQD QIAFIYKGQV VVDTSLPLGS  540
NDSSKIISVK PIALCATERA KFSVKGVNMS RPATRLLCAV EGKYLVQEAT HELMDDNDEF  600
KAQDELQYLN FSCSIPTVSG RGFIEIEDDG YNSSFFPFIV AEDDVCSEIR MLESLLEITD  660
AEAAVDRTGK MEAKNQAMDF IHEVGWLLHR SQLKSRLGDL VPNSAPFSLR RFKWLMEFSM  720
DHEWCAVIKK LLNVLLDGVV GSGEHPSLNL ALTEMGLLHR AVRKNCRPLV ELFLRFIPEK  780
GSSRLGLENE MVAGGIHESF LFRPDALGPS GLTPLHIAAG KDDSEDVLDA LTDDPGKVGI  840
DAWKSARDST GSTPEDYARL RGHYSYIHLI QKKINKRHSE HVVVDVPGPL SDCSTNRKQN  900
NESTSSFEIG QLELRSMKRH CKLCDQKLAY GYGTASRSLA YRPAMLSMVA IAAVCVCVAL  960
LFKSCPEVLY VFRPFRWELL DYGTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31146228384squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.211090.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223250.0KJ622325.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL17) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490238.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A088DKZ60.0A0A088DKZ6_G
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]