PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 420aa    MW: 45912.3 Da    PI: 7.6651
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0706genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.17.9e-41186262177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +CqvegC++ l +akeyhrrhkvCe+hskap+v+v g+eqrfCqqCsrfh +sefD++krsCrrrLa+hnerrrk +
  Gh_A11G0706 186 RCQVEGCDVALVNAKEYHRRHKVCEMHSKAPKVVVLGIEQRFCQQCSRFHVVSEFDDSKRSCRRRLAGHNERRRKGS 262
                  6*************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-35179248IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.402184261IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-38185265IPR004333Transcription factor, SBP-box
PfamPF031102.1E-32187260IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MENGGSMFLG NKGQTGNNSI NLAWDLRELN PTSTRFEWGG NDNINAFDLY ASTTSTTSSS  60
RAEMISSPSS TLPVANTAAP ALMFLPHHVN ATLAHHLNQE HSLYAGDGSH MHPDPHLVCL  120
KLGKRHYFED STSLTERHLV GGFSIGKKGN PYYNNNIGCG SGSVSGGVEP SSPIAVMGSP  180
ASTVPRCQVE GCDVALVNAK EYHRRHKVCE MHSKAPKVVV LGIEQRFCQQ CSRFHVVSEF  240
DDSKRSCRRR LAGHNERRRK GSHDSASRNS AQDAKLMTGR FPYHLSLPKG RALSLLSSRA  300
DSWISPSDLS SRSSAALQEL IAENRAAVLA RQVVLDRGWQ LNHRGMEDLG VFSSTMAEQH  360
SLLPAPPQGW EKFQETGAEL TLNLMQASSS ASGMFVRGKS EDEEQECSEL WNSLQGTHVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-30178260184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223320.0KJ622332.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489722.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ01JD19e-61SPL7_ORYSI; Squamosa promoter-binding-like protein 7
SwissprotQ7XT428e-61SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0D2QP600.0A0A0D2QP60_G
STRINGPOPTR_0002s14330.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15613914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-36squamosa promoter binding protein-like 3