PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 163aa    MW: 18277.7 Da    PI: 7.4412
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0617genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.21.4e-4311109199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kl++++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++++
  Gh_A11G0617  11 PCAACKFLRRKCMPDCVFAPYFPPEEPHKFINVHKIFGASNVSKLINEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVFRLQRELDAIH 108
                  7*********************************************************************************************9988 PP

       DUF260  99 e 99 
                  +
  Gh_A11G0617 109 A 109
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.11610111IPR004883Lateral organ boundaries, LOB
PfamPF031957.8E-4311107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASSSHSSNF PCAACKFLRR KCMPDCVFAP YFPPEEPHKF INVHKIFGAS NVSKLINEVA  60
PHQREDAVNS LAYEAEARLK DPVYGCVGAI SILQRQVFRL QRELDAIHAD LIRYATATCN  120
CNEMPPPMGR TSFHQNSSCN IYYPNPHWNE PYEGNGRSDG GSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-6321242119LOB family transfactor Ramosa2.1
5ly0_B1e-6321242119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016709390.11e-121PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML41e-66LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1U8L4401e-119A0A1U8L440_GOSHI; LOB domain-containing protein 25-like
TrEMBLA0A2P5XGR51e-119A0A2P5XGR5_GOSBA; Uncharacterized protein
STRINGGorai.007G075700.11e-114(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-69LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]