PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G2252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 246aa    MW: 28316.5 Da    PI: 5.7625
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G2252genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.81.4e-41141131100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp++++++f+n+hklFG+sn++k++k+l++ e+++am+++v++++ara+dPv G++++i++lq+q+e ++ael+l+ 
  Gh_A10G2252  14 ACAACKYQRRKCAPDCILAPYFPHDRQRQFQNAHKLFGVSNITKIIKNLNPPEKDIAMRTIVFQSDARANDPVGGCYRIIQELQRQIEYSQAELDLVF 111
                  7*********************************************************************************************9886 PP

       DUF260  99 ee 100
                  ++
  Gh_A10G2252 112 NQ 113
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87913114IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3814109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSIARTGSNG TTQACAACKY QRRKCAPDCI LAPYFPHDRQ RQFQNAHKLF GVSNITKIIK  60
NLNPPEKDIA MRTIVFQSDA RANDPVGGCY RIIQELQRQI EYSQAELDLV FNQLAICRAQ  120
AAQQQHSDLT LGCDMINPQD PLNSYNSNYY YVQEPHEELF AVNDNNQQHQ LQENYDHSWG  180
IQESTSALST LNIKQSFMKQ SEHNDVHEDE VKHDYGIACE RHEMKFENDD IVERRFVPST  240
QLVMSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-3081145111LOB family transfactor Ramosa2.1
5ly0_B8e-3081145111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016676738.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW15e-66LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A1U8IK250.0A0A1U8IK25_GOSHI; LOB domain-containing protein 22-like
STRINGGorai.011G064500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-68LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]