PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G2217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 141aa    MW: 16111.8 Da    PI: 8.0745
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G2217genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.67.3e-4355132178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+ad+++ak+yhrrhkvCe+h+ka+vv v+g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+++
  Gh_A10G2217  55 ACQVENCTADMTDAKRYHRRHKVCEFHAKAAVVRVAGIHQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSSS 132
                  5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.4E-611141IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.1E-3351117IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.5953130IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.03E-3954134IPR004333Transcription factor, SBP-box
PfamPF031107.3E-3356129IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MATSKAEGKR RLKEMGEEEE EEEEDEDNST TGDDDKKKKG KRGSSTVVGG SCLPACQVEN  60
CTADMTDAKR YHRRHKVCEF HAKAAVVRVA GIHQRFCQQC SRFHELSEFD ETKRSCRRRL  120
AGHNERRRKS SSEYHGEGSN F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3849129484squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.137810.0boll
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN7951320.0JN795132.1 Gossypium hirsutum SPL3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455582.13e-77PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387416e-55SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A0K0K3Z13e-98A0A0K0K3Z1_G
STRINGPOPTR_0001s40870.11e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.16e-44squamosa promoter binding protein-like 3