PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G2146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 173aa    MW: 19019.6 Da    PI: 5.6211
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G2146genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.72.4e-4461051100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  Gh_A10G2146   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKTLQELPLQQRADAVSSLVYEANARIRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 103
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Gh_A10G2146 104 AE 105
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7195106IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-436103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKT LQELPLQQRA  60
DAVSSLVYEA NARIRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEIVCIQ MQQDPIMVAA  120
NPQMVLGQAD DDDQAFLLQN QCFNFANNNS SSSAYVNIHE SLKRESIFGD IVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4721077112LOB family transfactor Ramosa2.1
5ly0_B2e-4721077112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017623360.11e-125PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D2UZ751e-123A0A0D2UZ75_GOSRA; Uncharacterized protein
TrEMBLA0A1U8LXG91e-123A0A1U8LXG9_GOSHI; LOB domain-containing protein 12-like
TrEMBLA0A2P5QGZ11e-123A0A2P5QGZ1_GOSBA; Uncharacterized protein
STRINGGorai.011G290800.11e-124(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-74LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]