PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G1752
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 367aa    MW: 39898.6 Da    PI: 5.3213
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G1752genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.92.8e-42147242297
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                  lfqrl+se+Dei+lL+G++d+ aktg++p++d+++fy+fvkksi+ +vsk ql++K+rrLKkKfk++v k k+g++p+fsk+h+qk+felskkiWg
  Gh_A10G1752 147 LFQRLFSEDDEIALLKGMLDYSAKTGADPHADMNGFYDFVKKSIHTNVSKVQLMDKVRRLKKKFKNNVGKNKKGEDPTFSKAHEQKAFELSKKIWG 242
                  69*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-36148242IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAPKHANPVE VPAPAFSSEE DEEVTSSEEV EEEGSSTEEE GEEDSKTKST PLIHNTPPPR  60
KLETANDESD ESGSDSESES DTALPVAIAT KPGSNKPLAS SSKRPGESGL DAKEGKRPKK  120
KVGGEGMATA PVVEEVKRTG EDAKKLLFQR LFSEDDEIAL LKGMLDYSAK TGADPHADMN  180
GFYDFVKKSI HTNVSKVQLM DKVRRLKKKF KNNVGKNKKG EDPTFSKAHE QKAFELSKKI  240
WGVSGKVESS TAKSNGKAKG NNKAVAALKA ELPSSSDKKT DNAVPIEVDN VVSKSSSSLL  300
DMKFSVSDTE VGVVKVGLDM VDGEKKAALE AKWRKLQMAQ LDLFVERTEF VTEQAKLALK  360
YYKSEDE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.15820.0boll| ovule| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454074.10.0PREDICTED: mediator-associated protein 1-like
RefseqXP_012454073.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D2TC680.0A0A0D2TC68_G
STRINGPOPTR_0001s30110.19e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.19e-30DNA-binding storekeeper protein-related transcriptional regulator