PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G0834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 303aa    MW: 33119.3 Da    PI: 7.3705
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G0834genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.45.8e-4471061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvhk+FGasnv kll++l++++reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l+ +k
  Gh_A10G0834   7 PCAACKFLRRKCTQECVFAPYFPPDNPQKFANVHKVFGASNVAKLLNELNTSQREDAVNSLAYEAEARLRDPVYGCVGLISILQHKLKQMQHDLNNAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_A10G0834 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0876107IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQKFANVH KVFGASNVAK LLNELNTSQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HKLKQMQHDL NNAKKELSTY IGPQAMLPIL  120
QPSVFLQQHV GNPSSSPSSS AVMQHNMMPM MGIPTAAAGA SGQLMLREPQ QQQIFEAQQQ  180
LAAVIAAREQ QEMFRGYEQH HGGQQPEIVR FNNGFEGSAS VTATGFNQIT TAAAVATMSP  240
SLALGSFENP YQIQAQQDHH HCHGGHHPLQ AQLLLQPQQG QPPQQQQPQR SGSEEARSIG  300
PSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-5041248129LOB family transfactor Ramosa2.1
5ly0_B1e-5041248129LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017648536.11e-174PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-94LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2P5Y6M60.0A0A2P5Y6M6_GOSBA; Uncharacterized protein
STRINGGorai.011G104600.11e-169(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-93ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]