PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G1553
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Dof
Protein Properties Length: 275aa    MW: 30610.2 Da    PI: 6.8287
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G1553genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.8e-4051110261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  +e+a+kcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+
  Gh_A09G1553  51 QEQAVKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKV 110
                  5799******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2745105IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99455109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGFTSLQVCM DSSDWLQGMT QEVPGMDSSS PCGDILTCSR PLIERRLRPP QEQAVKCPRC  60
DSTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV ATTKRSNDQS  120
ANNSAGSSMP HNPTDLHLSL PEMHLSHLNN ILGIHGSNTN FMESKYNPLL ENPGPIDFLS  180
RNYEGLGNGE LGMIGGLGDC SPYGMSLDGN VNTITFMDTY QRMTFPYAAN EDQHATDVKP  240
NTKLLSLDCW QDQGCSDTGK GTYGFFNNFG SWNDE
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the vascular tissues and pericycle of primary roots. Detected in the vasculature of the cotyledons, rosette leaves and cauline leaves. In flowers, localized in vasculature of petals, stigma, and stamen filaments, and, to a lower extent, in anthers and carpels. In inflorescence stems, accumulates in the vasculature, particularly in cambium, phloem, and interfascicular parenchyma cells. {ECO:0000269|PubMed:19915089}.
UniprotTISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). Preferentially expressed in the vasculature of all organs, including seedlings, roots, stems, buds, leaves, flowers and siliques, and particularly in the cambium, phloem and interfascicular parenchyma cells of inflorescence stems (PubMed:19915089). {ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016721367.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-49DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A1U8M3J80.0A0A1U8M3J8_GOSHI; dof zinc finger protein DOF5.6-like
STRINGGorai.006G188900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.18e-50Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]