PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G1263
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 644aa    MW: 70226.5 Da    PI: 7.5398
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G1263genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-093623991954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Gh_A09G1263 362 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 399
                  554459******************************88 PP

2BELL1201e-38226297172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vis Fe+ ag+g ak Yt+lAlk+iS++FrcLkdai++qi
  Gh_A09G1263 226 ERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVISTFEQTAGIGLAKTYTALALKTISKQFRCLKDAIIGQI 297
                  79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.5E-61148295IPR006563POX domain
PfamPF075264.1E-49153293IPR006563POX domain
PROSITE profilePS5007112.195340403IPR001356Homeobox domain
CDDcd000863.88E-12343404No hitNo description
SMARTSM003895.3E-9343407IPR001356Homeobox domain
SuperFamilySSF466898.13E-17344409IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-29346409IPR009057Homeodomain-like
PfamPF059202.6E-18360399IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MAAYFHGNPE IQAADDLQTL VLMNPAYVHY SNTPPPPPPS NNLVFLNSLS PNAPSSHSQQ  60
LVGIPLPAVT SGSNQDAISS LHGLVQRLHY NSYNPIDPSG APRDTPRAQQ GLSLTLSSQH  120
QPSNYGSQPQ AVSGGSASSG SAVTNGVSGI QSVLLSSKYL RAAQELLDEV VNVDNTGFTK  180
TEMAKKGCGN DSNRSKGTGE LSAAAGDGSG GEDAVGKRRT ELSTAERQEI QMKKAKLISM  240
LDEVDQRYRQ YHHQMQIVIS TFEQTAGIGL AKTYTALALK TISKQFRCLK DAIIGQIRAV  300
NKSLGEEDRL GGKTEGSRLK FVDHQLRQQR ALQQLGMIQH NAWRPQRGLP ERSVSVLRAW  360
LFEHFLHPYP KDSDKHMLAK QTGLTRSQVS NWFINARVRL WKPMVEEMYL EEIKEQEQNN  420
EDSASKSTGP TPAKNQAKSL SSSKQDNSAN QNASSMSISM ASTSPLAGNA QNQSGYSFIG  480
SSELEGITQG SPKKPRSTEV LLQSPIDMDT KQREAADDVS IKFGKEGYSF MGTDTNFIGG  540
FGQYPIAEMA RFDAEHFAPR FPGNGVSLTL GLPHCENLSL PATHQTFLPN QTLQMGRRLD  600
IGEPNEYGAI NPSTPHSSAA YEIENIDVQN RKRFAAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16349407563Homeobox protein Meis2
3k2a_B4e-16349407563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.253720.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016669348.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016669349.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016669350.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016669352.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016669353.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A1U8HZI00.0A0A1U8HZI0_GOSHI; BEL1-like homeodomain protein 1
STRINGGorai.006G149100.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-164BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]