PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 167aa    MW: 18740.6 Da    PI: 8.3386
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1109genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.51.3e-3917115199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaC++lrr+C ++C+lapyfp ++p kfa vhk+FGasnv+k+++ ++e++r+da+++lvyeA+ar+rdPvyG++g+i++lq+ ++ lk +l++++
  Gh_A08G1109  17 PCAACRMLRRRCDSNCILAPYFPGDEPDKFAGVHKVFGASNVIKMIQMVEETNRQDAVKALVYEARARLRDPVYGSTGTIFQLQKMVQDLKLQLKSTN 114
                  7******************************************************************************************9999877 PP

       DUF260  99 e 99 
                  +
  Gh_A08G1109 115 A 115
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.53916117IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4017114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGSQTPARLG IRTHHQPCAA CRMLRRRCDS NCILAPYFPG DEPDKFAGVH KVFGASNVIK  60
MIQMVEETNR QDAVKALVYE ARARLRDPVY GSTGTIFQLQ KMVQDLKLQL KSTNARVLEL  120
QQQKDQLLGI FMNVDHLDVP SSVDHGLSFS LDYEDSMASN LLIGKPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-351711811112LOB family transfactor Ramosa2.1
5ly0_B3e-351711811112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016724749.11e-123PREDICTED: LOB domain-containing protein 1-like
TrEMBLA0A1U8MGR71e-122A0A1U8MGR7_GOSHI; LOB domain-containing protein 1-like
TrEMBLA0A2P5YMK51e-122A0A2P5YMK5_GOSBA; Uncharacterized protein
STRINGGorai.004G151300.11e-117(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2496034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-45LOB domain-containing protein 11