PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G0326
Common NameSPL16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 982aa    MW: 109020 Da    PI: 6.3241
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G0326genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-40152229178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C+adls+ak+yhrrhkvCe+hska+++lv +++qrfCqqCsrfh l+efD++krsCrrrLa+hn+rrrk+++
  Gh_A08G0326 152 VCQVDDCRADLSDAKDYHRRHKVCEMHSKASKTLVGNVMQRFCQQCSRFHVLQEFDDGKRSCRRRLAGHNKRRRKRNP 229
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33146214IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017150227IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.22E-37151232IPR004333Transcription factor, SBP-box
PfamPF031102.2E-29153226IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.1E-5748867IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.49E-6749864IPR020683Ankyrin repeat-containing domain
CDDcd002049.68E-7750864No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MEARYGSEAQ LYGVSPEDLQ AVGKRTLEWN LNDWKWDGDL FVASRMNLVS ADGMGRQFFP  60
LGSSIPGNSS NSSSSCSDEV DLETERKREL EKRRRVTVVK DDSLNEEAGS LTLKLGGQDG  120
HGNPLSQRDT INWEGTSGKK TKLSGGSGNR AVCQVDDCRA DLSDAKDYHR RHKVCEMHSK  180
ASKTLVGNVM QRFCQQCSRF HVLQEFDDGK RSCRRRLAGH NKRRRKRNPE AVVNGNSLND  240
EQTSGYLLLS LLKILSNLHS NTSGQATDQD VLSHLLRSLA NHTNEQGGRN ISGLLPVPQD  300
IEAVSALFSN GQGPHQLFKQ HITGPALEMP QKAVCSHDTR GAKVQGSAAG VVKMNDFDLN  360
DIYIDSDNST DDIERSPAPV NIGTSSLDCP SWVQQTSHQS SPPQTSRNSD SASGQSPSSS  420
SGGAQSRTNR IVFKLFGKEP NDFPLVLRAQ ILDWLSHSPT DIESYIRPGC IVLTIYLRQA  480
EAAWDDLCSN LSFSLSRLLD CSDDTFWRTG WICIRVQDQI AFIYNGQVLV DTYLPLGSVR  540
YSKIVNVKPI AVSATERAQF SVKGINLSRP ATRLLCSVEG KYLVQNDSHE LIDDNDDFKE  600
QDELQCINFS CSIPTVTGRG FIEIEDPCFS SSFFPFIVAE DDVCSEIRML ESLLEITDTD  660
ADVGRMEAKN VAMDFIHEVG WLLHRSQLKS RLGQLDPSSE SFSLRRFKWL MEFSMDHEWC  720
AVVKKLLNIL LDGTVGSGEH HSIDLALTEM SLLHRAVRKN CRPLVELLLR FILENASDKL  780
GFENRTVAAG VDKTFLFRPD VLGPGGLTPL HIAAGKDGSE DVLDALTDDP GKVGIDAWNS  840
AQDSTGSTPE DYARLRGHYS YIHLVQRKIN KRSPSGHVVV DIPATPSVSS TNQKQNNETT  900
TSFEISQLEL RPVKRHCKLC DQKLPYSYGM VTNMSLSYRP AMLSMVAIAA VCVCVALLFK  960
SCPEVVYVFR PFRWELLDYG AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32144226384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.203090.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223240.0KJ622324.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL16) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473417.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A088DKA50.0A0A088DKA5_G
TrEMBLA0A0B0PPF90.0A0A0B0PPF9_G
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]