PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2309
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 270aa    MW: 29881.3 Da    PI: 7.7638
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2309genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.49.8e-38151151101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCa+Ck++rrkC+++C lap fpa+++k+f n++klFG++n++kl+++l+ ++r +a++++++eA++ra++Pv G++g+i +l++++ + k++l+l++
  Gh_A07G2309  15 ACAVCKYQRRKCTNNCLLAPFFPANRHKDFLNTRKLFGVRNIIKLIENLNFQQRVIAIRTIIFEANMRAQNPVGGCYGLICDLNNKIGEYKTQLNLVN 112
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  Gh_A07G2309 113 QQL 115
                  986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.26414115IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3415112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MQSHTATNSA AGSQACAVCK YQRRKCTNNC LLAPFFPANR HKDFLNTRKL FGVRNIIKLI  60
ENLNFQQRVI AIRTIIFEAN MRAQNPVGGC YGLICDLNNK IGEYKTQLNL VNQQLAIYKS  120
QSVFTQYQQQ QPQKQYNDGG DQNLDAGFSI FDGGGGGSSS PLLSAYDVFE SNLVKAELEG  180
SNVLSDVDED MKPLFGDNKR DQSFSFDSEG HVVFSDDKKE KQTFCVDSGG SKIQNSDQHV  240
SKQRGGLNQH QLKNDLNGGA SLFALTNGKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2171184114LOB family transfactor Ramosa2.1
5ly0_B4e-2171184114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6147750.0JX614775.1 Gossypium hirsutum clone NBRI_GE58409 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016716926.10.0PREDICTED: LOB domain-containing protein 22-like
RefseqXP_016716927.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A1U8LQS90.0A0A1U8LQS9_GOSHI; LOB domain-containing protein 22-like
STRINGGorai.001G022100.11e-171(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2211645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-36LOB domain-containing protein 22