PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G0593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family M-type_MADS
Protein Properties Length: 380aa    MW: 43744 Da    PI: 7.3747
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G0593genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.67.8e-24953145
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 kr e++snrqvt+skRr+gilKKA+ELS+LCd+ + +++fs+tgk
  Gh_A07G0593  9 KRLESYSNRQVTYSKRRTGILKKAKELSILCDIHIILLMFSPTGK 53
                 689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.077161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-25294IPR002100Transcription factor, MADS-box
CDDcd002664.72E-26282No hitNo description
PRINTSPR004041.6E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-201156IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRVKLKIKR LESYSNRQVT YSKRRTGILK KAKELSILCD IHIILLMFSP TGKPTLFHGE  60
RSNIEEVIVK FAQLTPQERA KRKLESLEAL KKTFMKLDHD LNIHDFLGAK YEMTKEVSRF  120
RAQLAEVHKR LSYWSNPDKI DNIEHLRQME DSLRESIERV RIHKENFGKH HLMSLECCNQ  180
VAKIFSPPVC VCFWERYLTT YDGLQFQNRI PLSVMIGAVQ EAQPVMWLPN NENHHMLLHN  240
ELNFLPHRDA ECSTDCSLAG YSGFFGSGKQ TEISSSGQVD NVVQECNALN ELGSNACLNL  300
EPGEQYFYQP YSASNYQDDE KLKTEMEVNL QGNPVVNQVI SNFEIPRPMY NNGHQAWVLS  360
SGPCGIAMFD GNSYHQVRII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-14192190Myocyte-specific enhancer factor 2B
1tqe_Q1e-14192190Myocyte-specific enhancer factor 2B
1tqe_R1e-14192190Myocyte-specific enhancer factor 2B
1tqe_S1e-14192190Myocyte-specific enhancer factor 2B
5f28_A1e-14192190MEF2C
5f28_B1e-14192190MEF2C
5f28_C1e-14192190MEF2C
5f28_D1e-14192190MEF2C
6c9l_A1e-14192190Myocyte-specific enhancer factor 2B
6c9l_B1e-14192190Myocyte-specific enhancer factor 2B
6c9l_C1e-14192190Myocyte-specific enhancer factor 2B
6c9l_D1e-14192190Myocyte-specific enhancer factor 2B
6c9l_E1e-14192190Myocyte-specific enhancer factor 2B
6c9l_F1e-14192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2364490.0HM236449.1 UNVERIFIED: Gossypium hirsutum MADS33-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016713099.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ7X9I03e-97AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A1U8LIT10.0A0A1U8LIT1_GOSHI; agamous-like MADS-box protein AGL65 isoform X2
STRINGGorai.001G074200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-91AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]