PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G2036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 387aa    MW: 43192.1 Da    PI: 7.8512
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G2036genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ334.46e-10317135037216
          VOZ  37 lalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysg 134
                   a+neg+pg+ pvlrp gi+lkdgllfaalsak+qgk+vgipec+gaataks wna elfdl +l+ge irewlffdkprrafesgnrkqrslpdy+g
  Gh_A06G2036 171 KAMNEGPPGMGPVLRPAGIGLKDGLLFAALSAKTQGKDVGIPECQGAATAKSLWNALELFDLLVLDGELIREWLFFDKPRRAFESGNRKQRSLPDYNG 268
                  599*********************************************************************************************** PP

          VOZ 135 rgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlt 216
                  rgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kksakgk  +d+++   k++grl+
  Gh_A06G2036 269 RGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAKGKPVNDTVSYQHKHMGRLS 350
                  ********************************************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGKGSKNNCK SASHKLFKDK AKNRVDDLQG MFLDLQFARK ESRGIDVAVL EEQLHQMLRE  60
WKAELNEPSP ASSLQQVRTA FIGGSLGSFS SDICRLLQLC EEEDDATSIL VVPKPEPNDQ  120
SLQVGDIAAS QERYAVNQGQ HECGFPLVDQ CKESPSQVQS VHFGIVQDLL KAMNEGPPGM  180
GPVLRPAGIG LKDGLLFAAL SAKTQGKDVG IPECQGAATA KSLWNALELF DLLVLDGELI  240
REWLFFDKPR RAFESGNRKQ RSLPDYNGRG WHESRKQVMN EFGGLKRSYY MDPQPLNHFE  300
WHLYEYEINK CDACALYRLE LKLVDGKKSA KGKPVNDTVS YQHKHMGRLS DGFSSEKKCC  360
FKGRTKVNAK IGVGNFFSHC KCSGTNE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.34870.0boll| ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576892.10.0transcription factor VOZ1 isoform X2
SwissprotQ9SGQ01e-112VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A072UMQ91e-178A0A072UMQ9_MEDTR; Putative transcription factor VOZ family
STRINGBra010864.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-114vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]