PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0849
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 631aa    MW: 68882.3 Da    PI: 7.6113
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0849genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.52.7e-13143182242
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                  ++k+CnCk+s+Clk+YCeCf++g +C+  C+C +C+N+ e+
  Gh_A06G0849 143 KQKQCNCKNSRCLKLYCECFSSGFYCNG-CNCLNCHNNVEN 182
                  89**************************.********9875 PP

2TCR50.15.4e-16227266140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+Ckks+ClkkYCeCf+a+  Cse+CkC dCkN e
  Gh_A06G0849 227 KHNKGCHCKKSSCLKKYCECFQANILCSENCKCMDCKNFE 266
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.0E-14142182IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.442143267IPR005172CRC domain
PfamPF036383.0E-10144179IPR005172CRC domain
SMARTSM011143.3E-19227268IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.3E-12230265IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MIGQGETVSD FTPKKLARQL DFTAGCRASG NAALPDHPMQ LQSQPQPQWQ SQTPLPTKSQ  60
QQPQELQLRL CLQPQTVQSP QSPPVPLVQI RPPPPPSQPV TVMQRVPHPV QKLPPQTYQL  120
SKQESPRSRP RVHADAKDGT PKKQKQCNCK NSRCLKLYCE CFSSGFYCNG CNCLNCHNNV  180
ENEAARQEAV GTTLERNPNA FRPKIASSPH RPQDTRDDAH DVQMVGKHNK GCHCKKSSCL  240
KKYCECFQAN ILCSENCKCM DCKNFEGSEE RRALVHGDHN SMAYMQQANA AISGAVGSSG  300
FGIPATSKKR KSEEIIFGLA VKDQSVHKIV QQQQQENHIR DLLATCSPLS THLSGTANKA  360
SLGSSKFTYR SPLANILQPQ YVKELCSVLV LVSSEAGRAL AAEKSGKKDQ QAKGDSIETT  420
VSSNQMHEMS ENGNGVLSSA TDDCESENHG DANRSGDCGA NEDSVQNGMP LSPRTRALMC  480
DEEDTMFMAV GSPDLLTDPS QNITQKSLNG HECTEVYAEQ ESLVLTVFRD FLNQLITRGS  540
IKETRCFPSP LSEKRSEQES AENGAIKSGN RAVGQKQPYP NGIVKSLNPA PAEISQTLSA  600
ATSVLNTDLP LKHESSIGKE DTKNVGIEGS N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-2914427611132Protein lin-54 homolog
5fd3_B2e-2914427611132Protein lin-54 homolog
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.27780.0ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6225212e-76JX622521.1 Gossypium hirsutum clone NBRI_GE69283 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016754927.10.0PREDICTED: protein tesmin/TSO1-like CXC 6 isoform X1
RefseqXP_016754928.10.0PREDICTED: protein tesmin/TSO1-like CXC 6 isoform X2
TrEMBLA0A1U8PX410.0A0A1U8PX41_GOSHI; protein tesmin/TSO1-like CXC 6 isoform X1
STRINGGorai.010G108300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-130Tesmin/TSO1-like CXC domain-containing protein