PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 248aa    MW: 27040.4 Da    PI: 9.8529
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0669genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.71.5e-3198154158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  d p+YVNaKQy++Il+RR  Rakle+++kl  ksrkpylheSRh hAl+R RgsgGrF
  Gh_A06G0669  98 DGPVYVNAKQYHGILRRRRYRAKLEAQNKL-VKSRKPYLHESRHLHALNRVRGSGGRF 154
                  57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-3596157IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.597157IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-23100122IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.4E-27100154IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860102122IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.2E-23131154IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MAEKERRWSK VDDINGGEDE SCGKDIEGQM KPINNPNTVF SPSNPNYNLS MASAQYPYAD  60
ICIGGLFTPY GQPAIIQAQM ARGSAPARLP LPLDLAEDGP VYVNAKQYHG ILRRRRYRAK  120
LEAQNKLVKS RKPYLHESRH LHALNRVRGS GGRFLSKKKL QQPHHPTSNP SSRSISDASC  180
LDRKNSGSEL GSHLHVGGCS SSSTSCSDIS SASNNNGSFQ LRKQGFIDIS PGVRSMCNGI  240
QNCASVGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2198164268NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450139.11e-154PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450140.11e-154PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450141.11e-154PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450142.11e-154PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0B0MNU51e-171A0A0B0MNU5_G
STRINGPOPTR_0006s14740.14e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2440034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.29e-35nuclear factor Y, subunit A7