PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 814aa    MW: 89885.6 Da    PI: 7.1062
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3908genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.51.1e-22176277199
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++ +g ++ p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + +++el+
  Gh_A05G3908 176 FCKTLTASDTSIHGGFSAPRRAAEDCfprldYKQTRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSVFVSQKNLIAGDAVLFL--RGEDGELR 271
                  99****************************8444556789************************************************..449999** PP

                  EEEE-S CS
           B3  94 vkvfrk 99 
                  ++++r+
  Gh_A05G3908 272 LGIRRA 277
                  ***996 PP

2Auxin_resp115.74e-38302383182
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                  +a+a+stksvF+v+Y+Pras++eFv++++k+ k+++++++ G Rf+m+fe++d +err+ G+v+g+ d+dp++WpnSkWr+L
  Gh_A05G3908 302 VANALSTKSVFQVCYCPRASHAEFVIPFQKYIKSITNPICTGARFRMKFEMDDLPERRCNGVVTGTGDSDPYKWPNSKWRCL 383
                  689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.1E-38167287IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.93E-42168289IPR015300DNA-binding pseudobarrel domain
CDDcd100178.54E-22174276No hitNo description
PROSITE profilePS5086312.393176278IPR003340B3 DNA binding domain
SMARTSM010191.8E-21176278IPR003340B3 DNA binding domain
PfamPF023623.8E-21176277IPR003340B3 DNA binding domain
PfamPF065072.2E-31302383IPR010525Auxin response factor
SuperFamilySSF542778.5E-10675758No hitNo description
PfamPF023092.4E-6675764IPR033389AUX/IAA domain
PROSITE profilePS5174520.708679761IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MEIDLNHALN EVEKTVLCNG SCEKASACVY CLSSSSSSSS SSSSSSSSTS CTSNSGSPPC  60
SSSIDLELWH ACAGPLTSLP KKGNVVVYFP QGHLEQLALA FPFSPLDTFD LPSQIFCKVM  120
NVQLLANKEN DEVYTQVTLL PQPELRGHNL GSKQLDEVEA DEHADGSPSK PTSHMFCKTL  180
TASDTSIHGG FSAPRRAAED CFPRLDYKQT RPSQELVAKD LHGVEWRFRH IYRGQPRRHL  240
LTTGWSVFVS QKNLIAGDAV LFLRGEDGEL RLGIRRAVRP RTGLPDSIIA QHNSYPKVLS  300
AVANALSTKS VFQVCYCPRA SHAEFVIPFQ KYIKSITNPI CTGARFRMKF EMDDLPERRC  360
NGVVTGTGDS DPYKWPNSKW RCLMVRWDDD IASDHQERVS PWEIDPSVFP PPLIIPSPFK  420
LKKLRTGLQT AALDTPVTGG VGYLDFEEST RSSKVLQGQE NVGFISPVYG CGTVNHPLHF  480
EMQSMAHQSL ASTGLGKSNI SDFMRAHSSS HTGFAETNRF PKVLQGQEIC SLRSLTHKAD  540
LNLGVWAKTN HGCNSFNMNQ APNTNFYPEG LRNMYFPYNE FYRAGQEPKM CSYASTLPRG  600
NVLFNASSIK PGVSVDDIRK PNPPNDHKPM ENIPSPGFGK KLRNQQDECY KGNVSGCKLF  660
GFSLTAESPT LNSQNSGKRS CTKVHKQGSL VGRAIDLSRL YGYKDLITEL EHLFGMEGLL  720
SAPDKGWRVL YTDRDNDVMV VGDDPWHEFC DVVSKIHIYT GEEVEKMTIG MGSDETQSCL  780
EEAAVIMEAS KSSSVGQPDS SPTVMRGMKI SACF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-118544067354Auxin response factor 1
4ldy_B1e-118544067354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.186870.0boll
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6277720.0KJ627772.1 Gossypium hirsutum auxin responsive factor ARF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016750756.10.0PREDICTED: auxin response factor 4-like isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A1U8PHR30.0A0A1U8PHR3_GOSHI; Auxin response factor
STRINGGorai.009G078800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]