PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3778
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 138aa    MW: 14682.5 Da    PI: 5.022
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3778genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26057.15.2e-18126448100
       DUF260  48 alpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ae++++++e
  Gh_A05G3778  12 EVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQSLQAEVHAVRAE 64 
                  7899********************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.034165IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-161262IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MTKCADTGSS LEVPESQRAD AANSLVYEAN VRLRDPVYGC MGAISALQHQ VQSLQAEVHA  60
VRAEILKYKY REANFIPSSL VALLSSGAVS VAPPPPPPQP PPPPPLPTTS TSTSSMYTQL  120
TTAADYTTIS NENVSYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-19128058126LOB family transfactor Ramosa2.1
5ly0_B6e-19128058126LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5257651e-157HQ525765.1 Gossypium herbaceum clone NBRI_D_2250-1 simple sequence repeat marker, mRNA sequence.
GenBankHQ5279961e-157HQ527996.1 Gossypium herbaceum clone NBRI_D_2250-2 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017614538.12e-85PREDICTED: LOB domain-containing protein 15-like
TrEMBLA0A0B0NU482e-65A0A0B0NU48_GOSAR; LOB domain-containing 15-like protein
STRINGGorai.012G015900.15e-64(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2780922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-31LOB domain-containing protein 13