PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 208aa    MW: 22440.5 Da    PI: 5.9103
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3659genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601314.8e-41641631100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p+kf ++h++FGasn++k l++lpe++r da+ss+vyeA  r+rdPvyG++g i++lq+q++ l+a+la+++
  Gh_A05G3659  64 PCAACKILRRRCVDKCVLAPYFPPTEPSKFIIAHRVFGASNIIKSLQELPESQRADAVSSMVYEASSRIRDPVYGSAGAIFQLQKQVSDLQAQLAKAQ 161
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_A05G3659 162 AE 163
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.94463164IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4164161IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MENNERGSIS PISIPTTFSY SPSSSPSSPL SQFSPSFPSP GSQSSSPPSP PRAAAASPQL  60
VLGPCAACKI LRRRCVDKCV LAPYFPPTEP SKFIIAHRVF GASNIIKSLQ ELPESQRADA  120
VSSMVYEASS RIRDPVYGSA GAIFQLQKQV SDLQAQLAKA QAEVVTMQCQ QANVLTLILE  180
MSQSKETIDT TCFLDDTCVV SPWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-416417111118LOB family transfactor Ramosa2.1
5ly0_B4e-416417111118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016718732.11e-149PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-69LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1U8LW421e-148A0A1U8LW42_GOSHI; LOB domain-containing protein 1-like
STRINGGorai.012G094200.11e-112(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-71LOB domain-containing protein 1