PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G2386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 328aa    MW: 35643.3 Da    PI: 5.8402
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G2386genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-09131179957
                  CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +    
  Gh_A05G2386 131 RIIANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTT 179
                  6678*********************************999877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-14123187IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.542127188IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.15E-10129178No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-10129181No hitNo description
PfamPF001706.5E-8130176IPR004827Basic-leucine zipper domain
CDDcd147032.18E-22131177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MQDPPSLDPN PDPPFPSNAS SSAAQTTPSF PHPTSFRGSY HRRVHSEVQF RIPDDLDLVS  60
DPFEGLGSED DLFCTYVDIE KLGGSSKGSE DGGGAAGSSS GGSGRNPEGE EMSGLSGKGE  120
KNNGGGKGRH RIIANRQSAA RSKERKARYI SELERKVQTL QTEATTLSAQ LTLFQRDTTG  180
LTTENTELKL RLQAMEQQAQ LRDALNEALK KEVERLKIAT GEITTPTDTF NLGMHHMPYN  240
QSSFFPPQPE HMQVDTQNIQ MPSFHPLRSN MLTPNQSVVT SSNSQAFADI MRQDPLGRLQ  300
GLDISSRSSH LVKSESPSIS AGESSGTL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.154420.0boll| ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016686327.10.0PREDICTED: transcription factor RF2b-like
SwissprotO228738e-89BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A1U8J7K90.0A0A1U8J7K9_GOSHI; transcription factor RF2b-like
STRINGGorai.009G293600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.17e-65basic leucine-zipper 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]