PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Nin-like
Protein Properties Length: 928aa    MW: 103320 Da    PI: 6.8398
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1538genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.23.3e-28603654152
       RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  aek+i+l++l++yFs ++kdAAk+Lgvc+T+LKr+CRq+GIkRWP+Rk++++
  Gh_A05G1538 603 AEKTITLQVLRQYFSESLKDAAKSLGVCPTTLKRTCRQHGIKRWPSRKLHKV 654
                  589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7593674IPR003035RWP-RK domain
PfamPF020421.5E-24606654IPR003035RWP-RK domain
SuperFamilySSF542771.04E-22829917No hitNo description
PROSITE profilePS5174526.156831914IPR000270PB1 domain
SMARTSM006662.2E-24831914IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.0E-21831911No hitNo description
PfamPF005645.3E-18832913IPR000270PB1 domain
CDDcd064077.63E-41833913No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 928 aa     Download sequence    Send to blast
MEDSILSPVM QLDYMDELLL DGCWLEASPT EGSDFLDPNA FFDPTFEWPT LDSNGGDLGG  60
SLFQGENQIS FLPGYPHMNE NHSQGAHLSP NLDDVDGMSR NLHGDCMTNT SELSRRWWIG  120
PRTNPGPSTS VMLRLIGALN HIKDSEKETD VLVQLWLPVN KGGRRILTTS EQPFLLDPNS  180
QRLASYRNIS VKYQFPAEED SKDMAGLPGR VFLSKVPEWT PDVRFFRSDE YHRVDHAQQH  240
GVRGTFALPV FEQGNRTCLG VIEVVMTTEK IKIKPEMESV CKALEAVNLR SFTASSTGNI  300
QACNSSYQAA LPEIKEVLKR ACETHRLPLA QTWVPCMQLG KEGCPHSTEN YFHCVSTVDD  360
ACYIAEPNIR GFHEVCSEHH LLKGQGVAGR AFMTNQPCFS TDITSFKKTE YPLAHHAKMF  420
KLHAAVAIRF RCIHTGKADF VLEFFLPADC RDPEGQKEML NSLSIILQQV CCSLRVVTNE  480
ELEEDRDMAV SEVIASLDGT PSRKELSEDQ CTYHSEKYSR ESSSWTVSLT EVNQSSSTST  540
STAMKLRKGK PRATWDEKLS KVKQHKKQIS LRGSVEGGDS TINEISFSSA TRRKTGQKRR  600
SKAEKTITLQ VLRQYFSESL KDAAKSLGVC PTTLKRTCRQ HGIKRWPSRK LHKVGNSLEK  660
LQHVIDSVQG VSGAFHISSL YPKFPELASP RPSGKSTSSA SVLGLNDKPK QKPILPEGGN  720
FVSQAATSNS PSSSCSQSSS SSHSCSSGTH QPSKFNISGN GGVIIGENSG NGELKRVTND  780
TELHTLSQEG LKLFPRSQSP ASVKEQLISD SIQPVITENN SQVAQDLDAQ TQKVKVTYGD  840
EKIRFRMQSK WRLKDLLLEI TRRFNIDDIS GFDLKYLDDD SEWVLLTCDA DLEECIDVCR  900
WCEGNTIRLL LQASHHHLDR SSGSTCPS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.216990.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016688002.10.0PREDICTED: protein NLP4-like
RefseqXP_016688003.10.0PREDICTED: protein NLP4-like
TrEMBLA0A1U8JH700.0A0A1U8JH70_GOSHI; protein NLP4-like
STRINGGorai.009G187500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein