PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1335
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 483aa    MW: 53796.2 Da    PI: 5.6264
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1335genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ434.81.2e-1332084232217
          VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                  ppsaflgpkcalwdc+rpaq  +w qdycssfha+la+neg+pg+ p+lrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspwna+elfdls
  Gh_A05G1335 208 PPSAFLGPKCALWDCPRPAQVLDWSQDYCSSFHAALAMNEGPPGMGPILRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATAKSPWNAPELFDLS 305
                  7************************************************************************************************* PP

          VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksak 197
                  +l+ge+irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kksak
  Gh_A05G1335 306 VLDGESIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYRLELKLVDGKKSAK 403
                  ************************************************************************************************** PP

          VOZ 198 gkvskdsladlqkklgrlta 217
                  gk ++d++adlqk++grlta
  Gh_A05G1335 404 GKSANDTVADLQKQMGRLTA 423
                  ******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MGKGSRSNCK SASHKLFKDR AKNRVDDLQG MFLDLQFARK ESRSVDVAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSSDICRL LQLCEEEDDA TSVLAAPKPE PNDQNLQVGD  120
TAAFQEGYGV NQGQHERGFP LVDHCKDSPS GVRTMPINNL DEATQLEYHQ FDLHQDFEHF  180
YTGFNGTGFS GEDAMLHTSS YLPSICLPPS AFLGPKCALW DCPRPAQVLD WSQDYCSSFH  240
AALAMNEGPP GMGPILRPGG IGLKDGLLFA ALSAKAQGKD VGIPECEGAA TAKSPWNAPE  300
LFDLSVLDGE SIREWLFFDK PRRAFESGNR KQRSLPDYSG RGWHESRKQV MNEFGGLKRS  360
YYMDPQPLNH FEWHLYEYEI NKCDACALYR LELKLVDGKK SAKGKSANDT VADLQKQMGR  420
LTAEFPTDNK RYVKGRAKIN AKVTVGNPYS TQNAVAPTSE KFDYGHGLQY DYLVDDLSGY  480
YLT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.36960.0boll| ovule| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016730807.10.0PREDICTED: transcription factor VOZ1
RefseqXP_016730808.10.0PREDICTED: transcription factor VOZ1
RefseqXP_016730809.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1U8MZ100.0A0A1U8MZ10_GOSHI; transcription factor VOZ1
STRINGGorai.009G165800.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]