PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 327aa    MW: 35845.9 Da    PI: 8.0877
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1140genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.92.5e-31173228258
    CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  ep+YVNaKQy++Il+RRq Rakle+++kl +k rkpy+heSRh hA++R+RgsgG+F
  Gh_A05G1140 173 EPIYVNAKQYHAILRRRQYRAKLEAQNKL-IKVRKPYMHESRHLHAIKRARGSGGQF 228
                  8****************************.*************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-35170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.263171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.8E-26173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.0E-23174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.0E-23205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MCTYVVGCSS LGNSTESQVQ QSSVSESLTL KMGVLPQHFH NNEQLSFQFQ DQDSSSTQST  60
GQSDPEVASA EDCNLYGQTL ISASSGGNGT HGKLVGNHAK LAYVMGTQDH VFPPSQVDYS  120
KPVAHIPHHY ANPYFGSVAA TAYGSQAMQI HHAHMMAMLP ARVPLPLDLK EGEPIYVNAK  180
QYHAILRRRQ YRAKLEAQNK LIKVRKPYMH ESRHLHAIKR ARGSGGQFLN TKKLQSKSTP  240
TSHGPDMSRS PQLHLSANIS VTDVHQPENF KDSGSATSCS DVTSASNSDE IFQQPDFRFY  300
SYPPDHTGEA MPGHAGNILL SSDRRAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20173236366NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.70340.0boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738515270.0
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445237.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012445238.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0D2QFW90.0A0A0D2QFW9_G
STRINGGLYMA07G04050.56e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.19e-57nuclear factor Y, subunit A3