PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 155aa    MW: 17267.6 Da    PI: 8.1155
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0943genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601309.9e-4161021100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dC++apyfp+++p++fa+vhk+FGasnv+k l+a   ++r da+ss+vyeA+arardPvyG+vg i+ lq+q++ql+ +l +++
  Gh_A05G0943   6 PCAACKLLRRRCAEDCIFAPYFPSQDPHRFAIVHKVFGASNVSKALQA---NQRGDAASSMVYEANARARDPVYGCVGAISYLQNQVSQLQMQLTVAQ 100
                  7*******************************************9999...99*****************************************9998 PP

       DUF260  99 ee 100
                  +e
  Gh_A05G0943 101 TE 102
                  86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.485103IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-406100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MRSCSPCAAC KLLRRRCAED CIFAPYFPSQ DPHRFAIVHK VFGASNVSKA LQANQRGDAA  60
SSMVYEANAR ARDPVYGCVG AISYLQNQVS QLQMQLTVAQ TELLRIKMHQ DSPSPPYLAP  120
TNNFNNIDSQ PEYLNFPPST NVIQDPSLKT ESIWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-42510510113LOB family transfactor Ramosa2.1
5ly0_B1e-42510510113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016752538.11e-110PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1U8PQB21e-109A0A1U8PQB2_GOSHI; LOB domain-containing protein 12-like
STRINGGorai.009G112900.11e-104(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-59LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]