PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0554
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 603aa    MW: 68073.6 Da    PI: 6.2431
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0554genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3431.96.3e-132404021337
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++r wkd+++l+r+ker+k     + +a++++ks++ ++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++r+WWkek
  Gh_A05G0554  40 DELERRIWKDRIKLRRIKEREKIA---ALQAVEKQKSKQASDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIRSWWKEK 134
                  79******************9974...45669****************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+ky+a++l+ s++++   ++ +++ sl++lqD+tlgSLLs+lmqhc+ppqr++plekgv+pPWWPtG+e+ww +lgl++ q+ ppyk
  Gh_A05G0554 135 VKFDKNGPAAIAKYEAECLAISESDNI--KKGNSQCSLQDLQDATLGSLLSSLMQHCKPPQRKYPLEKGVPPPWWPTGNEEWWVKLGLQQGQS-PPYK 229
                  **********************77666..89*************************************************************9.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX......XXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss......slrkqspkvtlsceqkedve 285
                  kphdlkk+wkv+vLtavikhmsp+i++ir+++ qsk+lqdkm+akes+++l vl++ee+++++ s +   ss        r+++++  +s ++++dv+
  Gh_A05G0554 230 KPHDLKKMWKVGVLTAVIKHMSPDIAKIRRHVHQSKCLQDKMTAKESAVWLGVLGREEALIQQPSCDkgiSSitekpqGGRDGKKRPAVSIDSDYDVD 327
                  ****************************************************************999665336666665667999999999999**** PP

                  XXXXXX.XXXXXXXXXX.......................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX. CS
         EIN3 286 gkkeskikhvqavktta.......................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgs 337
                  g ++ + + ++++++++                        ++ +  rk++++  +    + v ++ +++ ++++
  Gh_A05G0554 328 GVDDGRGSVSSKDDRRDqpidvepiayinnddshpvqenePVEKQPSRKRPRKGTNHGDRQTVPSHVDKQLVPSH 402
                  888888888888888778999999999998888888774433344445555555555555555555555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.9E-12540287No hitNo description
Gene3DG3DSA:1.10.3180.104.1E-70163294IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-61168290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MNRVLMVVDL LVDSSDLEVD DIRCDNIAEK DVSDEEIEAD ELERRIWKDR IKLRRIKERE  60
KIAALQAVEK QKSKQASDQA RRKKMSRAQD GILKYMLKLM EVCKARGFVY GIIPEKGKPV  120
SGASDNIRSW WKEKVKFDKN GPAAIAKYEA ECLAISESDN IKKGNSQCSL QDLQDATLGS  180
LLSSLMQHCK PPQRKYPLEK GVPPPWWPTG NEEWWVKLGL QQGQSPPYKK PHDLKKMWKV  240
GVLTAVIKHM SPDIAKIRRH VHQSKCLQDK MTAKESAVWL GVLGREEALI QQPSCDKGIS  300
SITEKPQGGR DGKKRPAVSI DSDYDVDGVD DGRGSVSSKD DRRDQPIDVE PIAYINNDDS  360
HPVQENEPVE KQPSRKRPRK GTNHGDRQTV PSHVDKQLVP SHDEHVNAEL RSPVPDINQT  420
DASFPEYNMP ATQQENDAST MLMHGEKHLI VQSELPAIPC ANEIFTQSMH VDGRPMLYPS  480
VQQTELHHRA AYEFYNPSVE FRHCRDGQQI QVGMNVPQIR PENGIDVSVP AGNDHVITGG  540
ELHHYMKDPF HDEQDRAVHN PFGSPTSDPS FYGGFNSPFE LPFNGTSSLE ELLDDDLIQY  600
FGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A4e-731672989140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444190.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_012444191.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_012444192.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0D2UHR50.0A0A0D2UHR5_G
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46582548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-169ETHYLENE-INSENSITIVE3-like 3