PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0176
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family CPP
Protein Properties Length: 490aa    MW: 53156.1 Da    PI: 8.3459
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0176genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR36.97.2e-1268105240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+ nCk+s+Clk+YCeCfa+g +C+e C+C +C  + 
  Gh_A05G0176  68 KQKHSNCKHSRCLKLYCECFASGMYCDE-CNCVNCYKNV 105
                  78999**********************9.******8665 PP

2TCR44.43.4e-14151187137
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCk 37 
                  k++kgC+Ck+s Cl+kYCeCf+a+  Cse+CkC +Ck
  Gh_A05G0176 151 KHSKGCHCKRSGCLRKYCECFQANILCSESCKCMGCK 187
                  589*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-1067107IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163431.09268191IPR005172CRC domain
PfamPF036385.1E-970102IPR005172CRC domain
SMARTSM011144.5E-14151190IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.0E-11154187IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MDVASWSPAA ASVNQRQQPQ IKQQVAATIS VAAGQSHPLT TASSSVVKPE SLKAKTRPNE  60
LNDGAPKKQK HSNCKHSRCL KLYCECFASG MYCDECNCVN CYKNVEYEAV RRDSVGATLK  120
SNLNAFRPKI NSSSHGAKDN KEAGEVLMLG KHSKGCHCKR SGCLRKYCEC FQANILCSES  180
CKCMGCKKFK GSEERQALFH GDYANNMAYI QQAANATTTG AIGSSGYASA PVSKKRKSQE  240
LLLGSTAKDP SVHSLGHLQQ TNLIRASIPS SSLSSMSVSR AGTAVGPSKL SYRSLFADII  300
QKQDLKELCS VLVVLSREAA KILADQRSLI EGGEDHSEIS LASSTQDKLE SQKDFVAEKT  360
RADNCSSSNQ AVKSDPENSC TDVADMPEGR PMSPATLALM CDEQDTTFTA AASLNGIMDD  420
GYSTSSQLPC GKGMIQIDAE HERVVLTKFR DCLNRLITFG EIKGKFPTPF SENSIHNELY  480
SMQQKGRNFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-29602002132Protein lin-54 homolog
5fd3_B2e-29602002132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016750094.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-158TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1U8PIQ70.0A0A1U8PIQ7_GOSHI; protein tesmin/TSO1-like CXC 5 isoform X1
STRINGGorai.009G025900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-156Tesmin/TSO1-like CXC domain-containing protein