PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G1331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 389aa    MW: 41290.7 Da    PI: 8.601
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G1331genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.7e-4288163176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dls+ak y++rhkvC +hsk+++v+v+gleqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk+
  Gh_A04G1331  88 RCQVEGCKVDLSDAKAYYSRHKVCCMHSKSSKVIVAGLEQRFCQQCSRFHQLSEFDKGKRSCRRRLAGHNERRRKP 163
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.90686163IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.1E-3286150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3987167IPR004333Transcription factor, SBP-box
PfamPF031102.5E-3189162IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEMGSGSLTE SGGSPTNSSA ESLNGLKFGK KIYFEDTAAV AAAAGGKSVG GGANIGTPSK  60
SGPASSSLAG SCRKARVDGM AQGVLPSRCQ VEGCKVDLSD AKAYYSRHKV CCMHSKSSKV  120
IVAGLEQRFC QQCSRFHQLS EFDKGKRSCR RRLAGHNERR RKPPPGSLFS SPYGRLSSSI  180
IENGSRGGSF IVDFSAYPRL SGRDAWPAAR SLECITGNRS TATGSSFSHP RQNNSSKPPH  240
DHFLQGSPCG TSFSSTGISP GECFTGSGDS SCALSLLSNQ PWGSRNQALN FSVNGVISTE  300
GSSAAQPTTP HGAVVNPYSN ASLDFNGSDT VRSSHKMLPH LDLGQIPDPV NCQFSSDLEL  360
SQQSWRSYME HEQSGAAYDD SMQHIHWTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31891621184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14451GGKSVGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.181440.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484406.10.0PREDICTED: squamosa promoter-binding-like protein 9 isoform X1
TrEMBLA0A0B0PFI80.0A0A0B0PFI8_G
STRINGVIT_08s0007g06270.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-68squamosa promoter binding protein-like 9