PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G2063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 603aa    MW: 68277.8 Da    PI: 5.4319
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G2063genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3471.26.9e-144504121353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkrlke++k+    k+  ++  k+++s+eqar+kkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWk+k
  Gh_A03G2063  50 DELERRMWRDKMRLKRLKEQNKS----KDG-VDIVKQRQSQEQARKKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDK 142
                  79*******************98....666.99***************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n i++++++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv pPWWPtG+e+ww++lgl+kdqg+ppyk
  Gh_A03G2063 143 VRFDRNGPAAIAKYQADNSIPGNNDGCNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVHPPWWPTGNEEWWPHLGLPKDQGPPPYK 239
                  ***************************88.9******************************************************************* PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedvegkkesk 291
                  kphdlkkawkv+vLta           ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++s    s+  +s ++++++ +++dveg +++ 
  Gh_A03G2063 240 KPHDLKKAWKVGVLTA-----------IRKLVRQSKCLQDKMTAKESATWLAIINQEETLARELYPESCpplSSGGGSGSLVINDCSEYDVEGADNEP 326
                  **************96...........89**************************************444456666****************777777 PP

                  .XXXXXXXXXX...........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta...........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                    +vq+ k  +                           ++++ rkrk ++ + ++++ k  ++ c+  q+++se +l+f+d+ ++++++
  Gh_A03G2063 327 NFDVQELKPGNlsssdlsvdrmraiqqppysikgevvnNLDFMRKRK-PSNDLNIMEHK--IYKCEFFQCPYSEHRLGFHDRAARDSHQ 412
                  699******99***********************************9.77777777666..6*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.8E-11750286No hitNo description
Gene3DG3DSA:1.10.3180.102.5E-60171296IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.19E-51176289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MMMFDDMGIC GDMDFFSAPF GEKDAATATL AASHAEPVED DYSDEEIDVD ELERRMWRDK  60
MRLKRLKEQN KSKDGVDIVK QRQSQEQARK KKMSRAQDGI LKYMLKMMEV CKAQGFVYGI  120
IPEKGKPVTG ASDNLREWWK DKVRFDRNGP AAIAKYQADN SIPGNNDGCN PIGPTPHTLQ  180
ELQDTTLGSL LSALMQHCDP PQRRFPLEKG VHPPWWPTGN EEWWPHLGLP KDQGPPPYKK  240
PHDLKKAWKV GVLTAIRKLV RQSKCLQDKM TAKESATWLA IINQEETLAR ELYPESCPPL  300
SSGGGSGSLV INDCSEYDVE GADNEPNFDV QELKPGNLSS SDLSVDRMRA IQQPPYSIKG  360
EVVNNLDFMR KRKPSNDLNI MEHKIYKCEF FQCPYSEHRL GFHDRAARDS HQLTCPYRNS  420
SALFSGSSFN VNEVKPVILP QAFAQSKPTA PAVTSVPTSF DLSGLGVPED GQKMISELMS  480
VYDNNIQGNK NMNPSNNPIT EGQNILHPKI QQPQDEYFRG QGNFFEDSSM PNNHQMFQQG  540
EGQFDRFKGL NSPFETEHNN NNNNSFPLMF GSPFDLCTFD YKEDLQTVGM DTIPRQDVSI  600
WFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-741752962134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-741752962134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.44541e-118boll| leaf| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5269930.0HQ526993.1 Gossypium herbaceum clone NBRI_B_3211 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471474.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471475.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471476.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471477.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
RefseqXP_012471478.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D2QKG70.0A0A0D2QKG7_G
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein