PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G1362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family VOZ
Protein Properties Length: 451aa    MW: 50324.2 Da    PI: 5.1417
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G1362genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ439.73.8e-1352004161217
          VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdl 98 
                  pppsaf+gpkcalwdctrpaqgs+w+qdycssfhatlalne++pgt+p+lrp+gi+lkd+ll++a++ak+qgk+vgip+cegaat+kspwna+elfdl
  Gh_A03G1362 200 PPPSAFMGPKCALWDCTRPAQGSDWFQDYCSSFHATLALNEDPPGTNPILRPGGISLKDNLLLDAVRAKAQGKNVGIPQCEGAATMKSPWNATELFDL 297
                  89************************************************************************************************ PP

          VOZ  99 sllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksa 196
                  sllege irewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkef+g+krsyymdpqps+++ewhl+eyei+ +da+alyrlelkl+++kks+
  Gh_A03G1362 298 SLLEGEIIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFAGQKRSYYMDPQPSGKYEWHLFEYEIYGCDAFALYRLELKLANQKKSP 395
                  ************************************************************************************************** PP

          VOZ 197 kgkvskdsladlqkklgrlta 217
                  k+kv kdsladlqkk+grlta
  Gh_A03G1362 396 KAKVPKDSLADLQKKMGRLTA 416
                  *******************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MQNNSSKNKC TSASHQQMVD NAKNRLNFLQ EQFTDLQAAR KEGRAGDVAV LEEQVYQNLR  60
EWKAELCTPS PASSLLGSLG SFSDDINRLL QLYEEEDDAT SPLKESAVLK PEIDDQSLNP  120
SSLPVIPEDY FVTHEPQEQS FQGFDLCKVS TSANADINYQ LDYHPFDLQQ DFDHGHLLDA  180
NGTEDYVKDA NSNMLPNISP PPSAFMGPKC ALWDCTRPAQ GSDWFQDYCS SFHATLALNE  240
DPPGTNPILR PGGISLKDNL LLDAVRAKAQ GKNVGIPQCE GAATMKSPWN ATELFDLSLL  300
EGEIIREWLF FDKPRRAFES GNRKQRSLPD YSGRGWHESR KQVMKEFAGQ KRSYYMDPQP  360
SGKYEWHLFE YEIYGCDAFA LYRLELKLAN QKKSPKAKVP KDSLADLQKK MGRLTAEVPG  420
DDKPPGKGKT KANKKAATAA AAVANVNSAQ D
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.83210.0boll| ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660929e-35AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016677761.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016677762.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_016677764.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_017616322.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_017616323.10.0PREDICTED: transcription factor VOZ1-like
RefseqXP_017616324.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-177VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A0B0MP390.0A0A0B0MP39_GOSAR; Serine carboxypeptidase-like 16
TrEMBLA0A1U8IHZ80.0A0A1U8IHZ8_GOSHI; transcription factor VOZ1-like
STRINGGorai.005G198500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-170vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]