PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G1256
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family EIL
Protein Properties Length: 505aa    MW: 57338.6 Da    PI: 4.8096
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G1256genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3415.65.5e-127333601353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  eelkkrmwkd+ +++rlke ++++  d+       +s  ++e++rrkkmsraQD+iLkYM+k+mevc+aqGfvYgi+pekgkpv+g+sdsLr+WWkek
  Gh_A02G1256  33 EELKKRMWKDRLRMQRLKEARESSRSDH-------QSGVRQEASRRKKMSRAQDSILKYMVKIMEVCKAQGFVYGIVPEKGKPVTGSSDSLRKWWKEK 123
                  8*****************9999865333.......445679********************************************************* PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ +p a+ +     +i++ + +l  ++ s  h l++lqDTtlgSLLsalmqhc ppqrrfple+g++pPWWPtG+elwwge+g+s++qg+ppy+
  Gh_A02G1256 124 VQFDKSAPLAVDEFL--PIIAE-QGEL--DPVSCMHLLHDLQDTTLGSLLSALMQHCAPPQRRFPLERGLAPPWWPTGNELWWGEQGISQEQGPPPYR 216
                  **********98773..34444.4444..689****************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikh 294
                  kphdlkkawkvsvL+avikhmsp+i++ir+l+ qsk+lqdkm+a+++ ++++v+nqee++++            ++ +++s  ++++ e+++e + ++
  Gh_A02G1256 217 KPHDLKKAWKVSVLAAVIKHMSPNIDRIRRLVTQSKCLQDKMTARDTVTWSNVVNQEEALLK----------LTEKCLKISPTKDDEEEQDSEYSLAA 304
                  **********************************************************9772..........35667788888777777777777554 PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 295 vqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                   + ++  ++++v  +++ k   +++v  +++ + cq+s +++s  el+f+ kn +s++e
  Gh_A02G1256 305 DEGKH-GEKITVSGEKR-KCLFKRQVTPNRI-YACQNSMCPRSALELGFTGKNTRSDHE 360
                  44444.46677777665.6888888888865.************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.4E-11833274No hitNo description
Gene3DG3DSA:1.10.3180.102.6E-69150278IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.11E-61153277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MVEILGEIEP PSPVYEAELP EEDEEQEEEI SYEELKKRMW KDRLRMQRLK EARESSRSDH  60
QSGVRQEASR RKKMSRAQDS ILKYMVKIME VCKAQGFVYG IVPEKGKPVT GSSDSLRKWW  120
KEKVQFDKSA PLAVDEFLPI IAEQGELDPV SCMHLLHDLQ DTTLGSLLSA LMQHCAPPQR  180
RFPLERGLAP PWWPTGNELW WGEQGISQEQ GPPPYRKPHD LKKAWKVSVL AAVIKHMSPN  240
IDRIRRLVTQ SKCLQDKMTA RDTVTWSNVV NQEEALLKLT EKCLKISPTK DDEEEQDSEY  300
SLAADEGKHG EKITVSGEKR KCLFKRQVTP NRIYACQNSM CPRSALELGF TGKNTRSDHE  360
SSCSYRSKES DVSQESSEES EFSNRNLVPY DHHSFGPQAK LNTDSLGDAQ KVLAVTDWLD  420
MELAKANDQH RNMQSDEVGD ISGTVSQDYI NYLGGAIEDL PVPAEFLLQL GDMDLDPSLP  480
LLLENIQEQG LTSIWDMGFD GISES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-601512781128Protein ETHYLENE INSENSITIVE 3
4zds_B2e-601512781128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469854.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-140EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A0D2MJ510.0A0A0D2MJ51_G
STRINGVIT_00s0357g00120.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-133EIL family protein