PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G0579
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 1041aa    MW: 115941 Da    PI: 7.688
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G0579genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-40158235178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+adls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Gh_A02G0579 158 VCQVEDCRADLSKAKDYHRRHKVCDVHSKATKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 235
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-31156220IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.077156233IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-37157237IPR004333Transcription factor, SBP-box
PfamPF031101.5E-28159232IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.51E-7807938IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.207.3E-6810926IPR020683Ankyrin repeat-containing domain
CDDcd002041.16E-6811922No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1041 aa     Download sequence    Send to blast
MEGKFGGKPH HFYGPTVSDL KAAEKKSVEW DLNDWKWDGD LFTATPLNPV PSDCRSRQLF  60
PDGPENAPNA GPSHSSSSCS EHSSPGNEKG KRKMQNKKRA VVVLDDDDDD DNDDDDDGVK  120
GDAGSLKLQL GGQVYPIMDE DAKCGKKTKV TGTPCRAVCQ VEDCRADLSK AKDYHRRHKV  180
CDVHSKATKA LVGNVMQRFC QQCSRFHVLQ EFDEGKRSCR RRLAGHNRRR RKTHPDNLPT  240
ANSLNDERNS SFLLISLLRI LSSMHSNNSD QAKDQDLLAH LLRSLANVAC STNGRNLSGF  300
LQGFHGAANA GRSLGNLEKP NDVVSGSTEH VRPSGSASKI DGCANLAEWQ GAMGYCGTVP  360
TSDLSHRRAN NDAQDGILSG SPSRTLIWSG AGFQPRASET GDTVERIRID KIDLNNVYDD  420
SQDYVENLER SLVLKNPVNG SLHGSVGVPE SLKSSPPQLS KNSDLTPSQS PSTSSGEAQS  480
RTDRIVFKLF GKNPNDFPIA LRRQILEWLS HSPTDIESYI RPGCIILTIY LCLRESAWEE  540
LCYDLGSSLR RLVDVSNDSF WKTGWVYARV QHSVAFIYNG RVVLDAPLPL KSHRNCKISS  600
IKPIAVSVTE RAQFVVKGFN LNQSSTRLLC AVEGKYLVQE TCYDLMDAVD PINEQDKLQH  660
LCFLCPIPNV SGRGFIEVED FGLSSTFFPF IVAEQEVCSE ICTLEGVIET AVPTVDINKN  720
EEKMETRNQA LDFIHEMGWL LHRNHLNRKL GDMNPNLNLF PFRRFKWLME FSMDHDWCAV  780
VKKLLGILFD RTVDLGDHSS MEFALLDMCL LHRAVRRNCR PMVELLLRYV PNKVLDKPGS  840
KQKLSVDGND YGFMFKPNVV GPAGLTPLHM VASREGCENV LDALTDDPGL VAIEAWKSAQ  900
DCTGLTPNDY ARLQGHYSYI HLVQRKINKK SECGYVVLDI PGTPLDCNSK QKLSDGTRSA  960
MAVSLEIQKI KKKPRQDGCK ACEKKLAYGN RTTSLVYRPT MLSMVAIAAV CVCVALLFKS  1020
SPEVLYVFRP FRWELLKYGS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-301582321084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1968974KIKKKPR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223090.0KJ622309.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482280.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_012482281.10.0PREDICTED: squamosa promoter-binding-like protein 1 isoform X1
TrEMBLA0A0D2RGS70.0A0A0D2RGS7_G
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1