PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G0446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 810aa    MW: 90583 Da    PI: 6.6971
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G0446genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.91.1e-36143218176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +Cqv++Cead++e+k yhrrh+vC +++++++vl++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k
  Gh_A02G0446 143 RCQVPACEADIAELKGYHRRHRVCLQCANSSTVLINGESKRYCQQCGKFHLLSDFDEGKRSCRRKLERHNNRRRRK 218
                  6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.1E-28138205IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.197141218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-32143221IPR004333Transcription factor, SBP-box
PfamPF031102.6E-26144218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MEQPASSPNT TPRGSPRSKD PQMDVHLPVT EPDLSFSSVW DWGDLLDFTL DDHFSISLDD  60
GNMYPPPFEA SPSVPDPDPE PVSGPDRVRK RDPRMTCSNF LAGRVPCACP EIDEQMEKLE  120
EEEAGAPGKK RARIGRVGSG TSRCQVPACE ADIAELKGYH RRHRVCLQCA NSSTVLINGE  180
SKRYCQQCGK FHLLSDFDEG KRSCRRKLER HNNRRRRKPV GSKTEVNKES LGALQSEDIG  240
CDGEAGKDDL SLSGQTAEEP PFESEDGLVS ADCSAPMLQT VNNDSTVALI DTGTDGGKED  300
LKFSISTSYH DNRTAYSSMC PTGRMSFKLY DWNPAEFPRR LRHQIFQWLA DMPVELEGYI  360
RPGCTILTVF ISMPKNMWKK LSENPMTYMH DFVFTPGRML HGRGLMTIHL NNMIFRTSKG  420
GSSLVKLDMG VQAPRLHYVH PSCFEAGKPM EFVACGSNLL QPKLQFLVSF AGRYLPYDYC  480
LASAHVNATE GSSSCDHQLY KIYVPQTESD LFGPVFIEVE NQSGLSNFIP VLIGDKDVCS  540
EMKVIQQGFE QGFDASLFWG GSQISANKSS CETSTLRQKA YSELVLDIAW LLREPKSENF  600
QETMASSQIQ RFNCLLNFLI QNKSTVILKK VLQNLKNVVE EAGFNGTDDP DTRLLKKYMD  660
YARDILKNKL QEGERPVLLS KYIEQEGKWN SQSSLKNDGL FVPNGSQDLG ERTNAKFQTM  720
MASTTLTRSE TVPLLNKEIV MNVNLSKERP RKSCSTIFAT TTLRSCPALF VVATAAICLG  780
ICAVFLHPTR VGEFAVTIRR CLSKRSYIIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-43142220482squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204216RRKLERHNNRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482069.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A0B0P9060.0A0A0B0P906_G
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.20.0squamosa promoter binding protein-like 7