PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G2095
Common NameSPL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 374aa    MW: 40445.1 Da    PI: 9.0131
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G2095genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.22e-4280155176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dl++ak y++rhkvC +hska++v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Gh_A01G2095  80 RCQVEGCKVDLTDAKAYYSRHKVCGMHSKAAKVIVAGLEQRFCQQCSRFHQLPEFDQRKRSCRRRLAGHNERRRKP 155
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-3474142IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.16378155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-4079159IPR004333Transcription factor, SBP-box
PfamPF031105.6E-3281154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEMGSGSLTD SGGSSSNSST ESLNGLKFGQ KIYFEDTSAA GTGGGTTMGT PLKSGIGSSS  60
SSGSGKKARG GVVQGGQPPR CQVEGCKVDL TDAKAYYSRH KVCGMHSKAA KVIVAGLEQR  120
FCQQCSRFHQ LPEFDQRKRS CRRRLAGHNE RRRKPPPGSL LSSRYIRLSS SIIESSRGGS  180
FIMDFTAYPR LSRRDVWLTS RSSEHVPGNQ YTGTGWLLPH PCQNNSENPP PNLYRQELPG  240
GTGVPSGRIP PGECFTGVVD SNCALSLLSN QPWGFRNQGL TLGLNDMINS ELCSMSQPAM  300
PHGAVTNPYS NASWGFKGNH SCSRSQDMLP QIPEPINSQL TGGLQLSHQS RGQYMEHEPS  360
NADDTSMQHN HQSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31811541184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136153RKRSCRRRLAGHNERRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103000.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223120.0KJ622312.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467002.10.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A088DJY90.0A0A088DJY9_G
STRINGVIT_08s0007g06270.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-52squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]