PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family TALE
Protein Properties Length: 634aa    MW: 69194.1 Da    PI: 7.2162
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1715genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093654021954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Gh_A01G1715 365 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 402
                  554459******************************88 PP

2BELL127.35.7e-41228299172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  erqe+q+kkakL+s+l+eVd+rY+qy++q+q+vissFe++ag+gsak YtslAlk+iS++FrcLkdai++qi
  Gh_A01G1715 228 ERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVISSFEQAAGIGSAKTYTSLALKTISKQFRCLKDAITGQI 299
                  79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-66154297IPR006563POX domain
PfamPF075261.3E-49159296IPR006563POX domain
PROSITE profilePS5007112.147343406IPR001356Homeobox domain
SMARTSM003891.8E-9346410IPR001356Homeobox domain
CDDcd000862.67E-12346407No hitNo description
SuperFamilySSF466896.84E-17347412IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28349412IPR009057Homeodomain-like
PfamPF059204.2E-18363402IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MATYFHGNPE IQAPDGLQTL VLMNPAYVQY SDTTPPPQPN NLVFHAPPPP QTQQFVGVPL  60
TATSTANQDP PSHEISPLHG LVQRVHYNLY NPIDPSGAAR ETPRAQQGLS LSLSSQQQQH  120
HHGYGSHAQA VSGEDMRVSG GSGSSGSGVT NGVSGVQSML LSSKFLKAAQ ELLDEVVNVN  180
NTGITKNELA KKGRGGGDNS NSSKVVGESA AAAGDADGKQ GPELTTAERQ EIQMKKAKLI  240
SMLDEVDQRY RQYHHQMQIV ISSFEQAAGI GSAKTYTSLA LKTISKQFRC LKDAITGQIR  300
AANKSLGDED CLGGSKIEGS RLKLVDHHLR QQRALQQLGM IQHNAWRPQR GLPERSVSVL  360
RAWLFEHFLH PYPKDSDKVM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE MYLEEIKEQE  420
QNGSEEKTSK SHNNEDSTSK STAPDKTSTE NKQDNNIPNQ NGCSSMSVSM GSASPLIGNQ  480
SGFSFIGSSE LEGITQGSPK KPRTNNEVTM KFDKDGYTFM GGTTNNDFMG GFGQYPIGEI  540
TRFDTEQFTP RFSGNGVSLT LGLPHCENLS LSGTPHQTFL PNQAMQMGRR VDIGEPNEFG  600
SINPSTPHSS AAYDNINIQN RKRFAAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B6e-16352409158Homeobox protein Meis1
4xrs_A6e-16352409158Homeobox protein Meis1
3k2a_B6e-16352410563Homeobox protein Meis2
3k2a_A6e-16352410563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.66950.0boll| leaf
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468114.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0B0MQX80.0A0A0B0MQX8_G
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-171BEL1-like homeodomain 1