PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 329aa    MW: 36143.8 Da    PI: 8.8141
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1710genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.81.1e-30162218158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  d p+YVNaKQy++Il+RRq+Rak+  e+kl +k+rkpy+h SRh hA+rRpRg+gGrF
  Gh_A01G1710 162 DGPIYVNAKQYNGILRRRQSRAKAVLENKL-TKARKPYMHYSRHLHAMRRPRGCGGRF 218
                  57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.446161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-26164218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21164186IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-21195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MAMQTLYAKE HDGIVHNPMG QLAPVPSQPW WSALGSQSSI YGESCGQLKN LLMEHPSNGD  60
QLTCTKQAGR VNEQGLNKGN PAHFTIFPGD GNCSGDGQKS PAVISLQSAP SEQHSRFELG  120
FGQPPMVCAK YPYMDQCYGV FSTYGPPVSG RVMLPLNIAS EDGPIYVNAK QYNGILRRRQ  180
SRAKAVLENK LTKARKPYMH YSRHLHAMRR PRGCGGRFLN TKTGKDEKET KKDEGKVLHT  240
TGSQNSEVLQ SDSGTLNSSK EAIGGGLTLS GSEVTSMYSR EELEHNFPIN HLGLSFHSFP  300
VMMENGRGSV MPNRWVAPAD HCLQPIPRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-16162222262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.61970.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468119.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A0B0PA670.0A0A0B0PA67_G
STRINGPOPTR_0016s06860.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.23e-54nuclear factor Y, subunit A10