PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family LBD
Protein Properties Length: 175aa    MW: 19291.8 Da    PI: 7.843
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0756genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260148.22.1e-46131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lq+q+++l+++lal++
  Gh_A01G0756  13 PCAACKLLRRRCAPDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQRQIDSLQNQLALAQ 110
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Gh_A01G0756 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.31412113IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MKENGRKHGA LSPCAACKLL RRRCAPDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQRQID SLQNQLALAQ AEVVHMRMRQ  120
FGSTSSNPGT NSADENIASV ADAPSKFMPS HHQSKSFFCV DMVDQPNIAE SLWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5391267124LOB family transfactor Ramosa2.1
5ly0_B3e-5391267124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.16581e-122stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9082587e-92DQ908258.1 Gossypium hirsutum clone LIB5327-030-A1-N1-H9_Gh319 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017629908.11e-129PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE96e-70LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2P5YH491e-128A0A2P5YH49_GOSBA; Uncharacterized protein
STRINGGorai.002G104500.11e-125(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-72LOB domain-containing protein 4