PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 182aa    MW: 20195.5 Da    PI: 8.4137
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0447genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.32.1e-4359135278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  Cqve+C +dls ak+yhrrhkvCe+h+kap v+v+g++qrfCqqCsrfhelsefDe+krsCr+rLa+hnerrrk++a
  Gh_A01G0447  59 CQVEKCGVDLSVAKRYHRRHKVCEIHAKAPIVVVAGIRQRFCQQCSRFHELSEFDEAKRSCRSRLAGHNERRRKSSA 135
                  **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3556120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.44556133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.11E-4057136IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3359132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MNKDFMAEDV DNDMEEEGGG EEEEEGAVYH GVQDDEKKKK ASGRRGSSGG VGGVLPPSCQ  60
VEKCGVDLSV AKRYHRRHKV CEIHAKAPIV VVAGIRQRFC QQCSRFHELS EFDEAKRSCR  120
SRLAGHNERR RKSSAESSAE GSSRKGTSPQ LKEGHCRQVD DQRARVPITI PGNSSFKCSH  180
IR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3646132184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6147631e-174JX614763.1 Gossypium hirsutum clone NBRI_GE58393 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458108.11e-128PREDICTED: squamosa promoter-binding protein 1
SwissprotQ9S7582e-46SPL5_ARATH; Squamosa promoter-binding-like protein 5
SwissprotQ9S7A91e-46SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A0B0PK171e-129A0A0B0PK17_G
STRINGPOPTR_0001s40870.12e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-37squamosa promoter binding protein-like 5