Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0360
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family BES1
Protein Properties Length: 325aa    MW: 35136.1 Da    PI: 8.4665
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0360genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sa++sp+ss++   
                  5899*******************************************************************************************... PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                       +sp++sy++sp+sssfpsp+s++ + + +   +sl+p+l++ls++sss+
                  .....*******************9999887766577**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.5E-663139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.152650.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431160.0AC243116.1 Gossypium raimondii clone GR__Ba0066P11-hvl, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455701.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1
RefseqXP_012455718.10.0PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2
SwissprotQ9ZV881e-141BEH4_ARATH; BES1/BZR1 homolog protein 4
STRINGVIT_19s0014g00870.t011e-160(Vitis vinifera)
STRINGPOPTR_0001s39520.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-124BES1/BZR1 homolog 4