PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0277
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GeBP
Protein Properties Length: 390aa    MW: 42897.1 Da    PI: 5.1032
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0277genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731314.5e-41168264298
       DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                  lfqrl+se+Dei+lL+G++d+ ak+g++p +d++afy+fvkksi+ +v+k q+++KirrLKkKf+++  k k+g++ +fsk+h+q++felsk+iWg+
  Gh_A01G0277 168 LFQRLFSEDDEIALLKGMLDYSAKKGADPCADMNAFYNFVKKSIHTDVTKAQMMDKIRRLKKKFENNAGKGKKGEDRTFSKAHEQNAFELSKMIWGK 264
                  79*********************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-34169263IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MAPKRSNPIE VPPAASSSEE DEEVTSSEEE EEGSSTEEED EEDPKTESTP LIQKSPPPRK  60
PETATPGVVN DESDESGSDS ESESDTATPN VKPLATKPME ESLNAKKPRS NKPLTSPIRA  120
SSSKRPGELD LDAKEAKRPK KKVGEEGLAT TPAAEEVKKT GEDAKKQLFQ RLFSEDDEIA  180
LLKGMLDYSA KKGADPCADM NAFYNFVKKS IHTDVTKAQM MDKIRRLKKK FENNAGKGKK  240
GEDRTFSKAH EQNAFELSKM IWGKEGISGK VESSAAKSNG KAKGNNKAVV ALKAEFSSPD  300
KKTYDAVPIE ADKVVSKSSR SLFDKRFGVS DMEEAVVKLG LDMVDGEKKA ALEAKWRKLQ  360
IAQLELFVER SELVTEQAKL VLEYYKSEDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.15820.0boll| ovule| root| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ7512650.0JQ751265.1 Gossypium hirsutum GL1-enhancer binding protein (GeBP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453826.10.0PREDICTED: mediator-associated protein 1-like isoform X1
TrEMBLA0A0D2Q0C70.0A0A0D2Q0C7_G
STRINGPOPTR_0001s30110.14e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.11e-39DNA-binding storekeeper protein-related transcriptional regulator