PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NAC
Protein Properties Length: 549aa    MW: 60482.1 Da    PI: 4.5968
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0073genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.21e-421943202128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  ppG+rF Ptdeel+++yL kkv+++ l+  + i e+d+y +eP +L +    ++e+ewyfF++r+kky++g r+ r+t++g+Wk tg dk++ + + +
  Gh_A01G0073 194 PPGVRFAPTDEELIQYYLLKKVNNELLPY-NLIWELDLYGTEPAKLTEsYEPNGESEWYFFTSRRKKYPNGGRPDRSTENGFWKPTGMDKNIPEGGLK 290
                  9***************************9.89**************8514445778**************************************9999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +g kktL f++gr+p+g+kt+W mhey++
  Gh_A01G0073 291 PIGSKKTLEFHTGRHPSGHKTEWKMHEYKV 320
                  9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-47191348IPR003441NAC domain
PROSITE profilePS5100548.17193348IPR003441NAC domain
PfamPF023651.2E-23194319IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MAANIENQND ISNPSIASNM DATVLEGGEI VTATENEAYN NILNYSAATD GGAIAYEGSE  60
FETMMEDIFN QNSTLSYFAA ADGGATAYEV GQFFTQEENI YNQNSVLNST VASNIDVAAF  120
EGDQFFSQDE NFYNELNVLS STVASNIETT AFEGGETVTT AENANNRNNM LNSSTASNGG  180
RTVAEVKDYI QSFPPGVRFA PTDEELIQYY LLKKVNNELL PYNLIWELDL YGTEPAKLTE  240
SYEPNGESEW YFFTSRRKKY PNGGRPDRST ENGFWKPTGM DKNIPEGGLK PIGSKKTLEF  300
HTGRHPSGHK TEWKMHEYKV DPSLIKPQNK PEDGMTLDTC VLCKVYKTQR KGQNENNLES  360
FDQNTNTSSS SQNFDVGASS EATIVSYPMT GFAGQPDNGL SPLTTSPMPN YEYYSNTWFQ  420
PTVDGALNNE AFVPAANRND TVIRNRNSDT TWPYHPYYSN GLLLHRGVNN GASTSTVARN  480
YIDNNVRAVQ VRPPNATLTQ VTVNNGGPNG EAHSMAASRS NTMSRGRGEA QRGSRRGGNR  540
GKIIMLPRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-3919235114171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468594.10.0PREDICTED: uncharacterized protein LOC105786622
TrEMBLA0A0D2M5500.0A0A0D2M550_GOSRA; Uncharacterized protein
STRINGGorai.002G008500.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2427034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.24e-42NAC domain containing protein 47